Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194XJH4

Protein Details
Accession A0A194XJH4    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
152-183MKEPPAKKAKVEKSKKEPKKLKVVKSQELKKVBasic
NLS Segment(s)
PositionSequence
97-120KEVKKVAVKEKKVAKGKGKGKEKA
155-176PPAKKAKVEKSKKEPKKLKVVK
Subcellular Location(s) cyto 21, nucl 4.5, mito_nucl 3
Family & Domain DBs
KEGG psco:LY89DRAFT_666749  -  
Amino Acid Sequences MPPKTKAPATGVEKYNLQLPMHLQLLYSIILEVGLPTGTEAWDRIASRIPVGEDGKDVPGTAIKKRWHRLETNLDKGELFGEDHKDILAESKTKVVKEVKKVAVKEKKVAKGKGKGKEKAQKVVEEIEDEEQDGDEVPEASSSKVAVEDEEMKEPPAKKAKVEKSKKEPKKLKVVKSQELKKVVENEVEEQQIEETEMDEIEIEEDVHPEVMEMEAEAGHEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.44
3 0.38
4 0.31
5 0.25
6 0.24
7 0.26
8 0.26
9 0.25
10 0.19
11 0.16
12 0.17
13 0.16
14 0.14
15 0.09
16 0.07
17 0.07
18 0.07
19 0.06
20 0.05
21 0.04
22 0.04
23 0.04
24 0.05
25 0.05
26 0.06
27 0.06
28 0.08
29 0.12
30 0.13
31 0.14
32 0.19
33 0.19
34 0.19
35 0.21
36 0.19
37 0.2
38 0.21
39 0.2
40 0.17
41 0.18
42 0.18
43 0.17
44 0.16
45 0.11
46 0.14
47 0.15
48 0.17
49 0.23
50 0.27
51 0.36
52 0.42
53 0.5
54 0.51
55 0.53
56 0.58
57 0.62
58 0.65
59 0.66
60 0.61
61 0.53
62 0.47
63 0.43
64 0.36
65 0.25
66 0.17
67 0.1
68 0.12
69 0.11
70 0.11
71 0.11
72 0.1
73 0.1
74 0.11
75 0.11
76 0.09
77 0.1
78 0.15
79 0.17
80 0.17
81 0.21
82 0.26
83 0.29
84 0.35
85 0.43
86 0.44
87 0.48
88 0.5
89 0.55
90 0.57
91 0.53
92 0.53
93 0.51
94 0.52
95 0.54
96 0.58
97 0.56
98 0.57
99 0.62
100 0.64
101 0.65
102 0.62
103 0.64
104 0.66
105 0.63
106 0.62
107 0.57
108 0.5
109 0.44
110 0.42
111 0.34
112 0.27
113 0.24
114 0.17
115 0.15
116 0.13
117 0.11
118 0.08
119 0.07
120 0.06
121 0.05
122 0.04
123 0.04
124 0.04
125 0.05
126 0.06
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.08
135 0.12
136 0.13
137 0.16
138 0.16
139 0.16
140 0.2
141 0.21
142 0.24
143 0.29
144 0.28
145 0.31
146 0.41
147 0.5
148 0.57
149 0.66
150 0.7
151 0.72
152 0.83
153 0.87
154 0.88
155 0.87
156 0.83
157 0.85
158 0.84
159 0.83
160 0.82
161 0.82
162 0.8
163 0.81
164 0.81
165 0.78
166 0.75
167 0.67
168 0.61
169 0.58
170 0.52
171 0.47
172 0.41
173 0.36
174 0.34
175 0.33
176 0.28
177 0.23
178 0.2
179 0.16
180 0.14
181 0.11
182 0.08
183 0.07
184 0.07
185 0.07
186 0.06
187 0.06
188 0.06
189 0.06
190 0.06
191 0.06
192 0.07
193 0.08
194 0.08
195 0.07
196 0.07
197 0.07
198 0.07
199 0.07
200 0.06
201 0.06
202 0.06