Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194XH36

Protein Details
Accession A0A194XH36    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-32FPIASHCHRNKHNHSRHRDSNAIHydrophilic
56-75ENNNRDSNRHRARNNRRCGVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, mito_nucl 13.666, cyto_nucl 10.833, mito 7.5
Family & Domain DBs
KEGG psco:LY89DRAFT_683340  -  
Amino Acid Sequences MRRKTNPTSFPIASHCHRNKHNHSRHRDSNAIINLNINHLLHRHRIPQSHQNNQHENNNRDSNRHRARNNRRCGVSARRRRFMRTLEPSAWRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.48
3 0.47
4 0.53
5 0.6
6 0.66
7 0.71
8 0.78
9 0.77
10 0.81
11 0.83
12 0.84
13 0.81
14 0.74
15 0.64
16 0.62
17 0.57
18 0.5
19 0.4
20 0.34
21 0.27
22 0.24
23 0.24
24 0.16
25 0.11
26 0.11
27 0.13
28 0.14
29 0.16
30 0.2
31 0.22
32 0.25
33 0.29
34 0.38
35 0.43
36 0.49
37 0.55
38 0.56
39 0.59
40 0.59
41 0.63
42 0.61
43 0.57
44 0.54
45 0.54
46 0.48
47 0.47
48 0.47
49 0.5
50 0.51
51 0.56
52 0.56
53 0.59
54 0.7
55 0.76
56 0.82
57 0.8
58 0.73
59 0.68
60 0.68
61 0.68
62 0.68
63 0.69
64 0.68
65 0.69
66 0.7
67 0.73
68 0.73
69 0.7
70 0.7
71 0.68
72 0.67
73 0.64