Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194X0S1

Protein Details
Accession A0A194X0S1    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
34-65TKISRKQQFRLERKYKRRAKLKWARPRWTKFVHydrophilic
NLS Segment(s)
PositionSequence
41-61QFRLERKYKRRAKLKWARPRW
Subcellular Location(s) mito 10, nucl 7.5, plas 7, cyto_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG psco:LY89DRAFT_591405  -  
Amino Acid Sequences MFSTLVRRSAQQKIPFDIYSNPYKAQRLWPPDFTKISRKQQFRLERKYKRRAKLKWARPRWTKFVKTMQLGSILFITVYGVLFLDWSKQGNPEHKPFEGVRWWNEYVRDIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.53
3 0.5
4 0.46
5 0.42
6 0.41
7 0.38
8 0.35
9 0.33
10 0.34
11 0.34
12 0.37
13 0.4
14 0.42
15 0.44
16 0.49
17 0.51
18 0.55
19 0.57
20 0.52
21 0.54
22 0.53
23 0.59
24 0.59
25 0.59
26 0.57
27 0.62
28 0.7
29 0.69
30 0.71
31 0.72
32 0.74
33 0.8
34 0.86
35 0.85
36 0.83
37 0.84
38 0.79
39 0.8
40 0.8
41 0.81
42 0.81
43 0.82
44 0.82
45 0.81
46 0.81
47 0.78
48 0.76
49 0.69
50 0.65
51 0.64
52 0.61
53 0.54
54 0.5
55 0.43
56 0.39
57 0.35
58 0.29
59 0.21
60 0.14
61 0.11
62 0.1
63 0.09
64 0.05
65 0.05
66 0.04
67 0.04
68 0.03
69 0.04
70 0.04
71 0.06
72 0.07
73 0.08
74 0.09
75 0.13
76 0.18
77 0.25
78 0.31
79 0.37
80 0.42
81 0.41
82 0.45
83 0.42
84 0.43
85 0.45
86 0.44
87 0.4
88 0.42
89 0.44
90 0.42
91 0.44