Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194XKM0

Protein Details
Accession A0A194XKM0    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
41-64MLYFYLRYRKRKKLAQRRDDEQYIHydrophilic
NLS Segment(s)
PositionSequence
51-51R
Subcellular Location(s) nucl 11, mito 5, cyto 4, plas 3, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG psco:LY89DRAFT_730774  -  
Amino Acid Sequences MESLTLLNRAILEARDKKSFWDKYKWLIIGGLIAVPIQLVMLYFYLRYRKRKKLAQRRDDEQYIQMPGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.3
4 0.34
5 0.42
6 0.49
7 0.46
8 0.49
9 0.48
10 0.5
11 0.57
12 0.53
13 0.44
14 0.36
15 0.31
16 0.22
17 0.19
18 0.13
19 0.06
20 0.05
21 0.04
22 0.03
23 0.03
24 0.02
25 0.02
26 0.02
27 0.03
28 0.03
29 0.04
30 0.04
31 0.06
32 0.14
33 0.2
34 0.29
35 0.37
36 0.47
37 0.55
38 0.64
39 0.74
40 0.78
41 0.84
42 0.85
43 0.86
44 0.83
45 0.83
46 0.79
47 0.7
48 0.63
49 0.56