Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194XTQ0

Protein Details
Accession A0A194XTQ0    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
210-232FDPEEYRREKERRDRERRAAAGABasic
NLS Segment(s)
PositionSequence
218-228EKERRDRERRA
Subcellular Location(s) nucl 15.5, cyto_nucl 15, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
KEGG psco:LY89DRAFT_186324  -  
Pfam View protein in Pfam  
PF12796  Ank_2  
Amino Acid Sequences MADIRAHPEQDEEHEGASPGELLIEAARRNNTDLLKEVLSSCKSEDEAAKLLNETKSVLGNYVYHEAALRGNYEIIDTLLDQPGFECDPISRIEGDTPLHSAIRYINSHFSTSPTNAELSTFASELISMMIEAGSDPKLKNKANLTPYQLVDPRNETLRQQIQDAVDVEMMRGDYIEEREEGDGRGDGGGDGGEDGEEDGDVGSGSDSDFDPEEYRREKERRDRERRAAAGANGGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.21
4 0.19
5 0.14
6 0.08
7 0.07
8 0.06
9 0.05
10 0.06
11 0.09
12 0.1
13 0.13
14 0.16
15 0.17
16 0.19
17 0.24
18 0.25
19 0.24
20 0.26
21 0.27
22 0.25
23 0.25
24 0.24
25 0.25
26 0.24
27 0.23
28 0.21
29 0.19
30 0.19
31 0.2
32 0.21
33 0.2
34 0.21
35 0.21
36 0.2
37 0.19
38 0.22
39 0.2
40 0.19
41 0.15
42 0.14
43 0.15
44 0.14
45 0.15
46 0.12
47 0.13
48 0.15
49 0.17
50 0.15
51 0.13
52 0.13
53 0.13
54 0.13
55 0.13
56 0.11
57 0.08
58 0.09
59 0.09
60 0.09
61 0.08
62 0.07
63 0.07
64 0.07
65 0.08
66 0.09
67 0.09
68 0.09
69 0.08
70 0.1
71 0.1
72 0.09
73 0.08
74 0.06
75 0.08
76 0.09
77 0.1
78 0.09
79 0.09
80 0.1
81 0.11
82 0.12
83 0.11
84 0.11
85 0.11
86 0.1
87 0.1
88 0.1
89 0.09
90 0.13
91 0.13
92 0.13
93 0.17
94 0.18
95 0.2
96 0.19
97 0.2
98 0.18
99 0.18
100 0.18
101 0.14
102 0.13
103 0.12
104 0.12
105 0.11
106 0.1
107 0.1
108 0.08
109 0.07
110 0.07
111 0.07
112 0.06
113 0.06
114 0.04
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.04
121 0.04
122 0.06
123 0.06
124 0.1
125 0.16
126 0.17
127 0.21
128 0.25
129 0.31
130 0.36
131 0.41
132 0.43
133 0.42
134 0.42
135 0.41
136 0.4
137 0.34
138 0.3
139 0.29
140 0.24
141 0.23
142 0.24
143 0.2
144 0.25
145 0.3
146 0.29
147 0.27
148 0.28
149 0.26
150 0.28
151 0.28
152 0.22
153 0.17
154 0.16
155 0.14
156 0.11
157 0.11
158 0.07
159 0.06
160 0.06
161 0.06
162 0.08
163 0.09
164 0.09
165 0.1
166 0.11
167 0.12
168 0.12
169 0.12
170 0.11
171 0.1
172 0.1
173 0.08
174 0.07
175 0.07
176 0.06
177 0.04
178 0.04
179 0.04
180 0.04
181 0.03
182 0.04
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.05
194 0.05
195 0.07
196 0.08
197 0.09
198 0.12
199 0.13
200 0.19
201 0.22
202 0.26
203 0.33
204 0.38
205 0.47
206 0.55
207 0.64
208 0.7
209 0.77
210 0.84
211 0.85
212 0.89
213 0.83
214 0.79
215 0.74
216 0.65