Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5A6K7

Protein Details
Accession E5A6K7   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
5-37TKSHTRDIIKPRHSQKSKKKAPSPRPSPRISRAHydrophilic
NLS Segment(s)
PositionSequence
14-36KPRHSQKSKKKAPSPRPSPRISR
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
Amino Acid Sequences MQSYTKSHTRDIIKPRHSQKSKKKAPSPRPSPRISRAHFDTRSKRIQPTWDELSPVAVRAVTAIVRMGATDDLERTHLYHFKNRPNSTQPHNPIPRQRKPFAHPPYSPRTLIKASNTCNADNAHVSLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.72
3 0.76
4 0.78
5 0.8
6 0.81
7 0.82
8 0.86
9 0.87
10 0.88
11 0.88
12 0.91
13 0.91
14 0.91
15 0.9
16 0.87
17 0.82
18 0.8
19 0.78
20 0.77
21 0.69
22 0.65
23 0.61
24 0.63
25 0.63
26 0.63
27 0.62
28 0.59
29 0.64
30 0.59
31 0.57
32 0.5
33 0.52
34 0.48
35 0.47
36 0.47
37 0.39
38 0.38
39 0.34
40 0.34
41 0.27
42 0.23
43 0.16
44 0.1
45 0.09
46 0.07
47 0.08
48 0.05
49 0.05
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.04
56 0.05
57 0.05
58 0.05
59 0.05
60 0.07
61 0.07
62 0.07
63 0.09
64 0.13
65 0.15
66 0.23
67 0.29
68 0.36
69 0.46
70 0.47
71 0.52
72 0.54
73 0.57
74 0.56
75 0.61
76 0.58
77 0.58
78 0.62
79 0.62
80 0.66
81 0.7
82 0.72
83 0.7
84 0.71
85 0.67
86 0.67
87 0.72
88 0.71
89 0.7
90 0.66
91 0.65
92 0.67
93 0.65
94 0.61
95 0.53
96 0.5
97 0.45
98 0.45
99 0.47
100 0.46
101 0.45
102 0.51
103 0.51
104 0.46
105 0.45
106 0.42
107 0.36
108 0.31