Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194XNY4

Protein Details
Accession A0A194XNY4   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
195-221GLPLREPQSYKNRRKIKPVRGSRLEDFHydrophilic
NLS Segment(s)
PositionSequence
180-187KKTKTREK
199-214REPQSYKNRRKIKPVR
Subcellular Location(s) mito 14, nucl 12, cyto_nucl 7.5
Family & Domain DBs
KEGG psco:LY89DRAFT_665871  -  
Amino Acid Sequences MPKASRRSSGAASVSRAEPYPAIKPGDKPSTTSAAKSTKRTSSQKASTSSKASDSKVLTEKSPNKLNVPTLQTPPNNNSFLDVTLDTDAIYDTCSTVRQIINALLGKDNKNPKNLNPADVDKDGNPKPFTKASFCRAVGSRPDMLRRFMAAKKMMGGAESAIYPPAYKFFENKRVWEGAKKTKTREKVESDRPHGLPLREPQSYKNRRKIKPVRGSRLEDFLDEYGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.35
3 0.32
4 0.26
5 0.22
6 0.21
7 0.23
8 0.24
9 0.28
10 0.28
11 0.33
12 0.39
13 0.47
14 0.44
15 0.42
16 0.42
17 0.46
18 0.45
19 0.42
20 0.4
21 0.4
22 0.44
23 0.47
24 0.49
25 0.48
26 0.56
27 0.61
28 0.62
29 0.63
30 0.66
31 0.66
32 0.68
33 0.66
34 0.62
35 0.6
36 0.53
37 0.5
38 0.46
39 0.41
40 0.4
41 0.35
42 0.36
43 0.37
44 0.37
45 0.32
46 0.37
47 0.42
48 0.42
49 0.48
50 0.44
51 0.42
52 0.43
53 0.45
54 0.42
55 0.42
56 0.4
57 0.36
58 0.41
59 0.4
60 0.4
61 0.4
62 0.39
63 0.34
64 0.3
65 0.29
66 0.23
67 0.21
68 0.2
69 0.17
70 0.13
71 0.12
72 0.12
73 0.1
74 0.09
75 0.08
76 0.06
77 0.06
78 0.05
79 0.04
80 0.05
81 0.05
82 0.06
83 0.09
84 0.09
85 0.09
86 0.1
87 0.1
88 0.14
89 0.14
90 0.15
91 0.14
92 0.16
93 0.17
94 0.21
95 0.29
96 0.27
97 0.31
98 0.32
99 0.31
100 0.4
101 0.4
102 0.38
103 0.33
104 0.33
105 0.32
106 0.31
107 0.31
108 0.21
109 0.26
110 0.25
111 0.25
112 0.24
113 0.21
114 0.23
115 0.26
116 0.27
117 0.27
118 0.3
119 0.3
120 0.36
121 0.36
122 0.35
123 0.33
124 0.34
125 0.31
126 0.31
127 0.31
128 0.25
129 0.31
130 0.3
131 0.31
132 0.29
133 0.27
134 0.27
135 0.25
136 0.3
137 0.26
138 0.25
139 0.24
140 0.25
141 0.23
142 0.19
143 0.17
144 0.11
145 0.1
146 0.09
147 0.08
148 0.07
149 0.06
150 0.07
151 0.06
152 0.09
153 0.11
154 0.12
155 0.16
156 0.23
157 0.33
158 0.36
159 0.39
160 0.41
161 0.43
162 0.44
163 0.47
164 0.47
165 0.48
166 0.54
167 0.56
168 0.59
169 0.63
170 0.7
171 0.7
172 0.71
173 0.69
174 0.7
175 0.76
176 0.79
177 0.77
178 0.75
179 0.69
180 0.66
181 0.61
182 0.53
183 0.49
184 0.47
185 0.46
186 0.43
187 0.43
188 0.45
189 0.51
190 0.6
191 0.64
192 0.66
193 0.7
194 0.71
195 0.82
196 0.85
197 0.85
198 0.85
199 0.86
200 0.87
201 0.85
202 0.88
203 0.8
204 0.77
205 0.67
206 0.57
207 0.5