Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194X790

Protein Details
Accession A0A194X790    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
92-118LEDLGRVERRRKKKKNKPESGKTKSVQBasic
127-155IKRRPIGILKTRKRMRKIKVESWMQRCRSHydrophilic
NLS Segment(s)
PositionSequence
99-145ERRRKKKKNKPESGKTKSVQKNDIVDRGIKRRPIGILKTRKRMRKIK
Subcellular Location(s) nucl 16.5, cyto_nucl 10.333, mito 4.5, cyto_mito 4.333, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG psco:LY89DRAFT_101906  -  
Amino Acid Sequences MPQHCNTCSHRCRCSPYNSTLHFLLYDNNPEMERYCYDDPDWPSTDSDRIFFFVLVILKILKLICAVVILVQKEIEEDERRSNVETRYEYLLEDLGRVERRRKKKKNKPESGKTKSVQKNDIVDRGIKRRPIGILKTRKRMRKIKVESWMQRCRSQQDHVTKRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.69
3 0.67
4 0.69
5 0.65
6 0.63
7 0.55
8 0.49
9 0.4
10 0.34
11 0.3
12 0.23
13 0.24
14 0.21
15 0.22
16 0.21
17 0.2
18 0.21
19 0.2
20 0.19
21 0.21
22 0.21
23 0.21
24 0.22
25 0.28
26 0.3
27 0.32
28 0.33
29 0.28
30 0.28
31 0.28
32 0.3
33 0.24
34 0.22
35 0.18
36 0.17
37 0.16
38 0.14
39 0.13
40 0.11
41 0.11
42 0.1
43 0.1
44 0.08
45 0.07
46 0.08
47 0.08
48 0.06
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.06
55 0.08
56 0.08
57 0.08
58 0.08
59 0.08
60 0.08
61 0.09
62 0.09
63 0.1
64 0.11
65 0.13
66 0.14
67 0.15
68 0.16
69 0.18
70 0.17
71 0.2
72 0.19
73 0.19
74 0.21
75 0.21
76 0.2
77 0.17
78 0.17
79 0.12
80 0.11
81 0.09
82 0.09
83 0.12
84 0.13
85 0.21
86 0.28
87 0.39
88 0.5
89 0.61
90 0.7
91 0.78
92 0.88
93 0.91
94 0.94
95 0.94
96 0.94
97 0.94
98 0.91
99 0.88
100 0.79
101 0.78
102 0.74
103 0.69
104 0.63
105 0.56
106 0.56
107 0.52
108 0.54
109 0.45
110 0.43
111 0.42
112 0.44
113 0.44
114 0.4
115 0.37
116 0.35
117 0.39
118 0.41
119 0.45
120 0.49
121 0.55
122 0.6
123 0.7
124 0.75
125 0.78
126 0.79
127 0.8
128 0.79
129 0.79
130 0.8
131 0.79
132 0.81
133 0.83
134 0.83
135 0.84
136 0.84
137 0.77
138 0.74
139 0.7
140 0.67
141 0.62
142 0.6
143 0.6
144 0.61