Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194X1A1

Protein Details
Accession A0A194X1A1    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
138-157SSRRALLHRFGNKQTRKKRKBasic
NLS Segment(s)
PositionSequence
147-157FGNKQTRKKRK
Subcellular Location(s) mito 15.5, mito_nucl 13, nucl 9.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG psco:LY89DRAFT_146685  -  
Amino Acid Sequences MSSQSSKSQSWVAMVKFTMLAMCMFSAGKQSEMKRPEAIPFHPTNQLPLMPPVKTRERFIPKYECPPQNPPHIARKGKEKAIDGCKENLPRSCSPFCIPDSSTDDVPYRDDLPTRSACAAPYCSDHTPPITPHPHISSSRRALLHRFGNKQTRKKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.22
4 0.21
5 0.17
6 0.12
7 0.11
8 0.08
9 0.08
10 0.07
11 0.07
12 0.07
13 0.12
14 0.12
15 0.14
16 0.18
17 0.21
18 0.28
19 0.31
20 0.34
21 0.33
22 0.33
23 0.36
24 0.36
25 0.36
26 0.35
27 0.35
28 0.35
29 0.37
30 0.36
31 0.33
32 0.3
33 0.29
34 0.23
35 0.25
36 0.25
37 0.2
38 0.22
39 0.24
40 0.31
41 0.32
42 0.33
43 0.37
44 0.43
45 0.47
46 0.5
47 0.54
48 0.48
49 0.55
50 0.61
51 0.56
52 0.52
53 0.56
54 0.54
55 0.54
56 0.55
57 0.49
58 0.5
59 0.53
60 0.52
61 0.46
62 0.52
63 0.48
64 0.48
65 0.47
66 0.41
67 0.4
68 0.44
69 0.46
70 0.38
71 0.36
72 0.36
73 0.36
74 0.36
75 0.33
76 0.31
77 0.29
78 0.33
79 0.32
80 0.31
81 0.29
82 0.3
83 0.28
84 0.27
85 0.25
86 0.24
87 0.28
88 0.28
89 0.27
90 0.25
91 0.25
92 0.21
93 0.22
94 0.19
95 0.16
96 0.14
97 0.15
98 0.15
99 0.19
100 0.2
101 0.21
102 0.21
103 0.2
104 0.2
105 0.21
106 0.23
107 0.19
108 0.21
109 0.24
110 0.24
111 0.26
112 0.26
113 0.26
114 0.27
115 0.28
116 0.32
117 0.33
118 0.33
119 0.36
120 0.38
121 0.41
122 0.43
123 0.46
124 0.47
125 0.47
126 0.52
127 0.5
128 0.48
129 0.48
130 0.51
131 0.55
132 0.55
133 0.56
134 0.57
135 0.65
136 0.72
137 0.77