Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194WW60

Protein Details
Accession A0A194WW60   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
7-26TNNGNAPKVRQAKKKAPPAPHydrophilic
NLS Segment(s)
PositionSequence
16-25RQAKKKAPPA
Subcellular Location(s) mito 17, cyto 8
Family & Domain DBs
KEGG psco:LY89DRAFT_688657  -  
Amino Acid Sequences MPPTSTTNNGNAPKVRQAKKKAPPAPAPAPAPLPAPAPTSTPSSKAWDIPDIPDVTNVRGKYRGEAHYRGTPPAGVCDHQWKLAFKALKDRLRKSSGLSVETIHKLEMLGWIYQVCLVRLGVRPRDNCKCDECKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.57
3 0.58
4 0.63
5 0.69
6 0.74
7 0.81
8 0.79
9 0.78
10 0.78
11 0.77
12 0.75
13 0.7
14 0.63
15 0.54
16 0.49
17 0.41
18 0.35
19 0.27
20 0.23
21 0.18
22 0.18
23 0.17
24 0.17
25 0.18
26 0.22
27 0.22
28 0.23
29 0.23
30 0.26
31 0.26
32 0.27
33 0.27
34 0.26
35 0.26
36 0.24
37 0.26
38 0.22
39 0.21
40 0.21
41 0.2
42 0.18
43 0.21
44 0.19
45 0.17
46 0.19
47 0.19
48 0.19
49 0.24
50 0.27
51 0.29
52 0.31
53 0.33
54 0.37
55 0.37
56 0.35
57 0.3
58 0.25
59 0.2
60 0.2
61 0.18
62 0.12
63 0.12
64 0.18
65 0.19
66 0.2
67 0.22
68 0.2
69 0.21
70 0.26
71 0.27
72 0.21
73 0.3
74 0.36
75 0.42
76 0.47
77 0.5
78 0.52
79 0.54
80 0.54
81 0.48
82 0.47
83 0.44
84 0.39
85 0.35
86 0.3
87 0.3
88 0.32
89 0.28
90 0.2
91 0.16
92 0.14
93 0.14
94 0.16
95 0.13
96 0.11
97 0.11
98 0.11
99 0.11
100 0.14
101 0.14
102 0.11
103 0.1
104 0.11
105 0.13
106 0.19
107 0.27
108 0.32
109 0.39
110 0.44
111 0.52
112 0.62
113 0.62
114 0.6
115 0.61