Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194XL76

Protein Details
Accession A0A194XL76    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
17-53ATPPQHRPSSPRKEKPRGFKKRKRKRSKSTSLVTRLSBasic
NLS Segment(s)
PositionSequence
22-44HRPSSPRKEKPRGFKKRKRKRSK
Subcellular Location(s) nucl 12, mito 11, cyto_nucl 8.5, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG psco:LY89DRAFT_419426  -  
Amino Acid Sequences MHIPNGKRGCQNSKVGATPPQHRPSSPRKEKPRGFKKRKRKRSKSTSLVTRLSSAGLLLLCRISTFADDRETSFEPHMFPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.49
3 0.5
4 0.47
5 0.47
6 0.5
7 0.5
8 0.47
9 0.45
10 0.49
11 0.52
12 0.58
13 0.62
14 0.63
15 0.66
16 0.75
17 0.81
18 0.86
19 0.87
20 0.87
21 0.87
22 0.87
23 0.88
24 0.89
25 0.94
26 0.94
27 0.94
28 0.93
29 0.93
30 0.93
31 0.91
32 0.88
33 0.86
34 0.81
35 0.74
36 0.64
37 0.54
38 0.44
39 0.35
40 0.26
41 0.17
42 0.11
43 0.08
44 0.07
45 0.06
46 0.06
47 0.06
48 0.06
49 0.07
50 0.06
51 0.08
52 0.1
53 0.12
54 0.16
55 0.17
56 0.19
57 0.24
58 0.26
59 0.26
60 0.26
61 0.26