Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194WV33

Protein Details
Accession A0A194WV33    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-31VNVPKTRRTYCKGKDCRKHTQHKVTQYKAGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 8, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG psco:LY89DRAFT_688330  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRRTYCKGKDCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTACKTKAQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.83
4 0.88
5 0.87
6 0.88
7 0.87
8 0.88
9 0.85
10 0.86
11 0.88
12 0.81
13 0.8
14 0.74
15 0.69
16 0.61
17 0.56
18 0.45
19 0.37
20 0.35
21 0.34
22 0.33
23 0.29
24 0.34
25 0.38
26 0.42
27 0.47
28 0.52
29 0.49
30 0.55
31 0.62
32 0.6
33 0.61
34 0.59
35 0.58
36 0.57
37 0.59
38 0.5
39 0.45
40 0.41
41 0.33
42 0.35
43 0.37
44 0.35
45 0.3
46 0.37
47 0.41
48 0.5
49 0.58
50 0.61
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.67
57 0.62
58 0.59
59 0.57
60 0.52
61 0.48
62 0.45
63 0.39
64 0.33
65 0.31
66 0.3
67 0.34
68 0.4
69 0.42
70 0.46
71 0.56
72 0.62
73 0.67
74 0.65
75 0.59
76 0.55
77 0.5
78 0.49
79 0.49
80 0.5
81 0.51
82 0.54
83 0.51
84 0.49
85 0.48
86 0.42