Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4ZU89

Protein Details
Accession E4ZU89    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MNPKSEKKKKNTDSNRAKTVIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MNPKSEKKKKNTDSNRAKTVIDYNIFHHDYFSIHPSIHVYASICVRHEPRATHTRVALLSTQLTHSIAVGAGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.86
3 0.77
4 0.68
5 0.58
6 0.52
7 0.47
8 0.39
9 0.32
10 0.28
11 0.32
12 0.33
13 0.3
14 0.26
15 0.2
16 0.18
17 0.18
18 0.18
19 0.12
20 0.11
21 0.11
22 0.12
23 0.12
24 0.11
25 0.1
26 0.08
27 0.09
28 0.11
29 0.12
30 0.11
31 0.13
32 0.14
33 0.18
34 0.2
35 0.21
36 0.25
37 0.33
38 0.36
39 0.37
40 0.36
41 0.36
42 0.33
43 0.34
44 0.28
45 0.22
46 0.2
47 0.18
48 0.18
49 0.16
50 0.16
51 0.14
52 0.12
53 0.11