Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194WV91

Protein Details
Accession A0A194WV91    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
42-69STLTGSPQNQKRNRKKRHNIHLYNPNTSHydrophilic
NLS Segment(s)
PositionSequence
55-57RKK
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
KEGG psco:LY89DRAFT_215024  -  
Amino Acid Sequences MVVIKLETTHHINHRPLIHNHHTNTPQSDRKFPSLPPSLRPSTLTGSPQNQKRNRKKRHNIHLYNPNTSDPTHVSGEQAIENNTVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.49
3 0.49
4 0.53
5 0.54
6 0.55
7 0.55
8 0.57
9 0.53
10 0.5
11 0.51
12 0.49
13 0.48
14 0.43
15 0.48
16 0.45
17 0.46
18 0.45
19 0.41
20 0.42
21 0.44
22 0.42
23 0.39
24 0.41
25 0.38
26 0.37
27 0.38
28 0.32
29 0.26
30 0.27
31 0.26
32 0.23
33 0.26
34 0.31
35 0.35
36 0.42
37 0.47
38 0.55
39 0.63
40 0.71
41 0.77
42 0.83
43 0.88
44 0.89
45 0.93
46 0.93
47 0.89
48 0.88
49 0.88
50 0.81
51 0.76
52 0.67
53 0.58
54 0.48
55 0.41
56 0.35
57 0.27
58 0.27
59 0.24
60 0.23
61 0.22
62 0.22
63 0.23
64 0.22
65 0.21
66 0.19