Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194WTS7

Protein Details
Accession A0A194WTS7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
146-171SLIIWFCLRRRKQKQNKSSNRYSLQDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 9, plas 6, mito 5, E.R. 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG psco:LY89DRAFT_243266  -  
Amino Acid Sequences MRFSLERAPADPSCAAGFLWYTCSDIDFYGCCSTDPCDAGCPDPASLTKTISTNSPLRTSTLTVSAAQSSTSLPLTSSSAPTTSVLNNADLAGFTTSMTISETGIPTSSPSPSASTASSTSNSTTNSIALIIGGAVAGVVVVSIMSLIIWFCLRRRKQKQNKSSNRYSLQDSLPPYGIPTKDFVLDRTTGPALSLQESEPFAPFGGMSFLSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.13
4 0.14
5 0.1
6 0.13
7 0.12
8 0.12
9 0.12
10 0.13
11 0.13
12 0.12
13 0.13
14 0.11
15 0.13
16 0.15
17 0.15
18 0.14
19 0.15
20 0.17
21 0.19
22 0.19
23 0.17
24 0.18
25 0.19
26 0.2
27 0.23
28 0.22
29 0.18
30 0.19
31 0.19
32 0.19
33 0.19
34 0.19
35 0.17
36 0.17
37 0.17
38 0.17
39 0.21
40 0.22
41 0.24
42 0.25
43 0.24
44 0.25
45 0.27
46 0.26
47 0.23
48 0.22
49 0.21
50 0.18
51 0.19
52 0.18
53 0.16
54 0.14
55 0.13
56 0.09
57 0.09
58 0.09
59 0.08
60 0.07
61 0.08
62 0.1
63 0.11
64 0.12
65 0.11
66 0.11
67 0.12
68 0.12
69 0.13
70 0.11
71 0.13
72 0.12
73 0.12
74 0.12
75 0.11
76 0.1
77 0.08
78 0.09
79 0.06
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.06
86 0.05
87 0.05
88 0.06
89 0.06
90 0.06
91 0.06
92 0.06
93 0.07
94 0.07
95 0.07
96 0.07
97 0.08
98 0.09
99 0.1
100 0.12
101 0.11
102 0.12
103 0.14
104 0.14
105 0.15
106 0.14
107 0.14
108 0.14
109 0.14
110 0.14
111 0.13
112 0.11
113 0.1
114 0.1
115 0.08
116 0.06
117 0.05
118 0.04
119 0.03
120 0.03
121 0.02
122 0.02
123 0.02
124 0.02
125 0.01
126 0.01
127 0.01
128 0.01
129 0.01
130 0.01
131 0.01
132 0.02
133 0.02
134 0.02
135 0.03
136 0.04
137 0.05
138 0.07
139 0.17
140 0.23
141 0.34
142 0.45
143 0.56
144 0.66
145 0.77
146 0.85
147 0.87
148 0.93
149 0.91
150 0.9
151 0.88
152 0.83
153 0.75
154 0.69
155 0.63
156 0.55
157 0.51
158 0.44
159 0.38
160 0.33
161 0.3
162 0.27
163 0.27
164 0.24
165 0.21
166 0.2
167 0.19
168 0.22
169 0.23
170 0.22
171 0.21
172 0.22
173 0.22
174 0.24
175 0.23
176 0.19
177 0.19
178 0.21
179 0.18
180 0.19
181 0.19
182 0.15
183 0.18
184 0.19
185 0.2
186 0.18
187 0.17
188 0.15
189 0.13
190 0.12
191 0.1
192 0.11