Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A132B7Y2

Protein Details
Accession A0A132B7Y2   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
177-204AAAGGEKKAPKKEKKQPAVGRAERKTRSBasic
NLS Segment(s)
PositionSequence
163-205TKNGDNKKKPGRPKAAAGGEKKAPKKEKKQPAVGRAERKTRSQ
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021331  Hva1_TUDOR  
KEGG psco:LY89DRAFT_691302  -  
Pfam View protein in Pfam  
PF11160  Hva1_TUDOR  
Amino Acid Sequences MSEQVQEGDKVSWNWNGSHPSGTAAEVKAGEVTVTSHRGNEISKTGDASNPAVHIERSGNDVVKTANELNVEKKAEGSSSSNGDAVNGESKQEEEKEKKPEEEKEAEQNPEEEEEEEKKDEAQTGEKRKADEKADAGEEAEDKKEEEGEEPKKQKTSNGTAATKNGDNKKKPGRPKAAAGGEKKAPKKEKKQPAVGRAERKTRSQAKSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.32
4 0.3
5 0.31
6 0.28
7 0.26
8 0.25
9 0.25
10 0.23
11 0.19
12 0.19
13 0.17
14 0.17
15 0.14
16 0.13
17 0.11
18 0.08
19 0.09
20 0.11
21 0.14
22 0.14
23 0.15
24 0.15
25 0.17
26 0.18
27 0.19
28 0.19
29 0.19
30 0.19
31 0.21
32 0.21
33 0.21
34 0.22
35 0.21
36 0.18
37 0.15
38 0.16
39 0.15
40 0.14
41 0.14
42 0.13
43 0.12
44 0.15
45 0.16
46 0.16
47 0.15
48 0.16
49 0.14
50 0.13
51 0.16
52 0.12
53 0.13
54 0.13
55 0.14
56 0.16
57 0.2
58 0.2
59 0.17
60 0.18
61 0.16
62 0.14
63 0.15
64 0.16
65 0.14
66 0.15
67 0.16
68 0.16
69 0.15
70 0.15
71 0.13
72 0.11
73 0.11
74 0.09
75 0.09
76 0.08
77 0.09
78 0.1
79 0.11
80 0.15
81 0.17
82 0.22
83 0.29
84 0.31
85 0.34
86 0.36
87 0.39
88 0.4
89 0.4
90 0.37
91 0.37
92 0.38
93 0.36
94 0.33
95 0.29
96 0.23
97 0.2
98 0.18
99 0.11
100 0.1
101 0.11
102 0.12
103 0.13
104 0.12
105 0.11
106 0.11
107 0.13
108 0.11
109 0.16
110 0.22
111 0.28
112 0.35
113 0.36
114 0.37
115 0.38
116 0.42
117 0.37
118 0.35
119 0.3
120 0.26
121 0.26
122 0.25
123 0.23
124 0.18
125 0.17
126 0.13
127 0.12
128 0.09
129 0.08
130 0.08
131 0.09
132 0.09
133 0.11
134 0.17
135 0.22
136 0.31
137 0.34
138 0.37
139 0.39
140 0.4
141 0.42
142 0.42
143 0.44
144 0.45
145 0.49
146 0.51
147 0.5
148 0.52
149 0.51
150 0.46
151 0.45
152 0.45
153 0.45
154 0.46
155 0.52
156 0.6
157 0.65
158 0.71
159 0.75
160 0.76
161 0.73
162 0.77
163 0.78
164 0.77
165 0.76
166 0.7
167 0.65
168 0.61
169 0.63
170 0.61
171 0.6
172 0.6
173 0.63
174 0.69
175 0.74
176 0.79
177 0.81
178 0.87
179 0.88
180 0.88
181 0.89
182 0.87
183 0.87
184 0.83
185 0.83
186 0.76
187 0.72
188 0.72
189 0.71