Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A132B300

Protein Details
Accession A0A132B300   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
13-36EEDKIEHPPPPPKPKRRPTTETEEAcidic
NLS Segment(s)
PositionSequence
24-28PKPKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
KEGG psco:LY89DRAFT_558624  -  
Amino Acid Sequences YGKAEKLEFYNDEEDKIEHPPPPPKPKRRPTTETEEEYKHRIKEWEALMPHAREVKVQGNSMTQKYYVDRLLPIYCQAIESMRHIDDKPWLLQEDSDPSHSMRKKELAQEYKSAHNIQNLVHPAQSPDLNPIKAIWSIIKQRLRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.27
4 0.24
5 0.2
6 0.25
7 0.31
8 0.39
9 0.49
10 0.58
11 0.65
12 0.73
13 0.81
14 0.86
15 0.87
16 0.85
17 0.8
18 0.8
19 0.78
20 0.73
21 0.67
22 0.62
23 0.55
24 0.54
25 0.52
26 0.42
27 0.36
28 0.33
29 0.3
30 0.32
31 0.31
32 0.33
33 0.29
34 0.32
35 0.33
36 0.32
37 0.31
38 0.27
39 0.25
40 0.18
41 0.2
42 0.23
43 0.22
44 0.22
45 0.21
46 0.23
47 0.25
48 0.26
49 0.24
50 0.18
51 0.16
52 0.16
53 0.18
54 0.14
55 0.13
56 0.12
57 0.14
58 0.14
59 0.13
60 0.13
61 0.11
62 0.1
63 0.09
64 0.09
65 0.08
66 0.08
67 0.1
68 0.12
69 0.11
70 0.13
71 0.13
72 0.14
73 0.17
74 0.18
75 0.18
76 0.17
77 0.17
78 0.16
79 0.16
80 0.17
81 0.18
82 0.17
83 0.18
84 0.17
85 0.17
86 0.25
87 0.27
88 0.28
89 0.26
90 0.3
91 0.32
92 0.4
93 0.48
94 0.49
95 0.49
96 0.54
97 0.53
98 0.53
99 0.52
100 0.47
101 0.4
102 0.36
103 0.34
104 0.28
105 0.33
106 0.31
107 0.29
108 0.27
109 0.24
110 0.23
111 0.24
112 0.25
113 0.18
114 0.22
115 0.26
116 0.26
117 0.26
118 0.25
119 0.24
120 0.24
121 0.25
122 0.2
123 0.22
124 0.3
125 0.38