Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194XDQ4

Protein Details
Accession A0A194XDQ4    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
250-272AQFINQRDEDRRRERQRRLQVRHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto 4
Family & Domain DBs
KEGG psco:LY89DRAFT_44812  -  
Amino Acid Sequences MAAPFRAWLDSDEVPAIGFATTPRRVESPDSFFESLSKSKKAPESGPLSFSRTSTSSSSGSSDGSVTDDTPSRKSSASTAPSTAPSIDVQVPWHVHVAHLPQPTAVPITARYSLPCEFLFAGCQIAFPPDEYENWILHSLTHFPRSDPPKKCVCTICDNDDAVFSTEGDQRSRILNWSTRMHHIGEHFEHEYIYEDMRPDFFVIKHVESRLNEEDFKSAMSYSERPPINNLVSYGFKTPAMRRQERRDNAQFINQRDEDRRRERQRRLQVRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.15
4 0.09
5 0.08
6 0.08
7 0.14
8 0.18
9 0.19
10 0.21
11 0.22
12 0.25
13 0.31
14 0.37
15 0.37
16 0.38
17 0.44
18 0.42
19 0.41
20 0.39
21 0.37
22 0.36
23 0.34
24 0.32
25 0.26
26 0.32
27 0.38
28 0.41
29 0.4
30 0.43
31 0.46
32 0.45
33 0.49
34 0.45
35 0.44
36 0.39
37 0.36
38 0.32
39 0.25
40 0.25
41 0.23
42 0.24
43 0.21
44 0.22
45 0.23
46 0.21
47 0.2
48 0.17
49 0.15
50 0.11
51 0.12
52 0.11
53 0.09
54 0.1
55 0.13
56 0.15
57 0.17
58 0.18
59 0.18
60 0.18
61 0.19
62 0.21
63 0.26
64 0.29
65 0.3
66 0.3
67 0.3
68 0.31
69 0.31
70 0.27
71 0.2
72 0.14
73 0.15
74 0.14
75 0.13
76 0.12
77 0.15
78 0.15
79 0.15
80 0.16
81 0.13
82 0.12
83 0.14
84 0.16
85 0.19
86 0.2
87 0.19
88 0.17
89 0.18
90 0.18
91 0.17
92 0.13
93 0.08
94 0.08
95 0.11
96 0.13
97 0.13
98 0.13
99 0.15
100 0.16
101 0.18
102 0.16
103 0.15
104 0.14
105 0.14
106 0.14
107 0.11
108 0.11
109 0.08
110 0.09
111 0.07
112 0.07
113 0.07
114 0.07
115 0.08
116 0.08
117 0.08
118 0.11
119 0.13
120 0.12
121 0.13
122 0.13
123 0.11
124 0.1
125 0.11
126 0.12
127 0.12
128 0.16
129 0.15
130 0.15
131 0.22
132 0.3
133 0.38
134 0.38
135 0.41
136 0.46
137 0.47
138 0.5
139 0.48
140 0.44
141 0.43
142 0.43
143 0.44
144 0.39
145 0.37
146 0.34
147 0.3
148 0.27
149 0.2
150 0.16
151 0.11
152 0.1
153 0.13
154 0.14
155 0.14
156 0.14
157 0.13
158 0.15
159 0.15
160 0.16
161 0.16
162 0.2
163 0.24
164 0.29
165 0.31
166 0.33
167 0.34
168 0.32
169 0.31
170 0.28
171 0.29
172 0.25
173 0.26
174 0.24
175 0.22
176 0.21
177 0.19
178 0.2
179 0.15
180 0.14
181 0.11
182 0.11
183 0.11
184 0.12
185 0.12
186 0.11
187 0.12
188 0.11
189 0.14
190 0.17
191 0.19
192 0.22
193 0.23
194 0.27
195 0.26
196 0.33
197 0.33
198 0.32
199 0.31
200 0.29
201 0.29
202 0.24
203 0.24
204 0.18
205 0.13
206 0.12
207 0.15
208 0.17
209 0.18
210 0.26
211 0.26
212 0.26
213 0.3
214 0.34
215 0.33
216 0.32
217 0.31
218 0.26
219 0.28
220 0.29
221 0.28
222 0.23
223 0.22
224 0.25
225 0.28
226 0.32
227 0.39
228 0.46
229 0.52
230 0.61
231 0.7
232 0.73
233 0.79
234 0.79
235 0.77
236 0.71
237 0.73
238 0.69
239 0.62
240 0.64
241 0.56
242 0.52
243 0.53
244 0.57
245 0.57
246 0.59
247 0.66
248 0.69
249 0.77
250 0.83
251 0.85
252 0.89