Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194WXH3

Protein Details
Accession A0A194WXH3    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-31ESKNSSQHNQSKKAHRNGIKKPKTSRYPSLKHydrophilic
NLS Segment(s)
PositionSequence
12-39KKAHRNGIKKPKTSRYPSLKGTDPKFRR
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG psco:LY89DRAFT_592434  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences ESKNSSQHNQSKKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKALVSGQYLDFLQHGANFLAEGREGGRRQVMSLTTISSFDYGSGICIGKGAFWRQIRANPHLQQPDSRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.82
4 0.84
5 0.87
6 0.86
7 0.83
8 0.83
9 0.83
10 0.83
11 0.81
12 0.8
13 0.78
14 0.76
15 0.74
16 0.71
17 0.68
18 0.66
19 0.63
20 0.63
21 0.59
22 0.61
23 0.64
24 0.67
25 0.7
26 0.69
27 0.75
28 0.67
29 0.72
30 0.65
31 0.65
32 0.62
33 0.54
34 0.48
35 0.39
36 0.35
37 0.25
38 0.23
39 0.15
40 0.09
41 0.07
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.06
48 0.05
49 0.05
50 0.06
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.09
60 0.1
61 0.1
62 0.13
63 0.13
64 0.14
65 0.16
66 0.15
67 0.14
68 0.14
69 0.15
70 0.13
71 0.13
72 0.13
73 0.11
74 0.1
75 0.08
76 0.08
77 0.07
78 0.07
79 0.08
80 0.08
81 0.07
82 0.08
83 0.08
84 0.09
85 0.13
86 0.15
87 0.21
88 0.22
89 0.27
90 0.3
91 0.37
92 0.42
93 0.45
94 0.51
95 0.48
96 0.55
97 0.59
98 0.57