Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A132B537

Protein Details
Accession A0A132B537    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
55-85FAARKAKKEVQKQVKKQVSKQVQKHAQKRAEHydrophilic
NLS Segment(s)
PositionSequence
58-84RKAKKEVQKQVKKQVSKQVQKHAQKRA
Subcellular Location(s) extr 10, mito 6, cyto 3, E.R. 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG psco:LY89DRAFT_742756  -  
Amino Acid Sequences MAPILIVKDLLSRRAISKALHIFLGIFITLVILGILGVIVYLFCVHYLPTIFLNFAARKAKKEVQKQVKKQVSKQVQKHAQKRAEKHQREADGAAGAGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.22
4 0.29
5 0.32
6 0.31
7 0.3
8 0.28
9 0.24
10 0.22
11 0.22
12 0.13
13 0.07
14 0.05
15 0.05
16 0.05
17 0.04
18 0.04
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.01
27 0.02
28 0.02
29 0.02
30 0.02
31 0.03
32 0.03
33 0.04
34 0.05
35 0.06
36 0.07
37 0.07
38 0.07
39 0.07
40 0.11
41 0.1
42 0.13
43 0.2
44 0.19
45 0.21
46 0.28
47 0.33
48 0.38
49 0.47
50 0.54
51 0.58
52 0.68
53 0.73
54 0.78
55 0.81
56 0.78
57 0.74
58 0.74
59 0.73
60 0.73
61 0.72
62 0.72
63 0.74
64 0.79
65 0.81
66 0.81
67 0.79
68 0.77
69 0.77
70 0.78
71 0.79
72 0.75
73 0.76
74 0.75
75 0.71
76 0.67
77 0.61
78 0.52
79 0.42