Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194XJ62

Protein Details
Accession A0A194XJ62    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
88-127SRSKSTGKGRIEKRRSSRKTSIVFPKYKNGKRIGKPKGKKBasic
NLS Segment(s)
PositionSequence
91-127KSTGKGRIEKRRSSRKTSIVFPKYKNGKRIGKPKGKK
Subcellular Location(s) mito 12.5, nucl 11.5, cyto_mito 8.333, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG psco:LY89DRAFT_780000  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKGARASTRKANNVRLKSKVFSPVESARVERLSAKLLELASQPKPEPAKEDVVMDAEDSAREGGDAVLDADNKQTEDMELDQDPATSRSKSTGKGRIEKRRSSRKTSIVFPKYKNGKRIGKPKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.75
3 0.73
4 0.69
5 0.62
6 0.6
7 0.59
8 0.51
9 0.44
10 0.44
11 0.42
12 0.41
13 0.4
14 0.37
15 0.3
16 0.28
17 0.27
18 0.22
19 0.19
20 0.18
21 0.17
22 0.16
23 0.16
24 0.15
25 0.15
26 0.16
27 0.18
28 0.17
29 0.18
30 0.18
31 0.2
32 0.22
33 0.2
34 0.23
35 0.22
36 0.25
37 0.23
38 0.24
39 0.2
40 0.2
41 0.19
42 0.15
43 0.12
44 0.07
45 0.06
46 0.06
47 0.05
48 0.04
49 0.03
50 0.04
51 0.03
52 0.03
53 0.03
54 0.04
55 0.04
56 0.05
57 0.05
58 0.05
59 0.06
60 0.06
61 0.06
62 0.05
63 0.05
64 0.07
65 0.07
66 0.09
67 0.09
68 0.11
69 0.1
70 0.11
71 0.12
72 0.12
73 0.13
74 0.11
75 0.12
76 0.15
77 0.18
78 0.24
79 0.31
80 0.38
81 0.42
82 0.51
83 0.6
84 0.66
85 0.72
86 0.75
87 0.78
88 0.8
89 0.8
90 0.8
91 0.79
92 0.78
93 0.75
94 0.75
95 0.76
96 0.74
97 0.75
98 0.69
99 0.7
100 0.72
101 0.73
102 0.72
103 0.7
104 0.71
105 0.73
106 0.8
107 0.81