Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194X520

Protein Details
Accession A0A194X520    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-34IPTSADPRSKRPTKKRALSPRSQTASHydrophilic
NLS Segment(s)
PositionSequence
17-24SKRPTKKR
Subcellular Location(s) nucl 20.5, cyto_nucl 13, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
KEGG psco:LY89DRAFT_540735  -  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSEPIPESIPTSADPRSKRPTKKRALSPRSQTASQISSLMSKPDTVINLPSTSITTHPGSAPPEIVQNVQGSSAGAGSGEFHVYKASRRREYERLRGMEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.43
4 0.51
5 0.6
6 0.67
7 0.73
8 0.77
9 0.83
10 0.87
11 0.88
12 0.88
13 0.87
14 0.85
15 0.84
16 0.79
17 0.7
18 0.61
19 0.53
20 0.46
21 0.37
22 0.29
23 0.19
24 0.17
25 0.16
26 0.16
27 0.12
28 0.1
29 0.1
30 0.11
31 0.11
32 0.1
33 0.11
34 0.11
35 0.11
36 0.11
37 0.11
38 0.1
39 0.09
40 0.09
41 0.11
42 0.1
43 0.1
44 0.11
45 0.13
46 0.14
47 0.14
48 0.14
49 0.11
50 0.13
51 0.13
52 0.13
53 0.13
54 0.12
55 0.12
56 0.11
57 0.11
58 0.08
59 0.07
60 0.07
61 0.05
62 0.04
63 0.04
64 0.05
65 0.06
66 0.07
67 0.07
68 0.07
69 0.1
70 0.11
71 0.18
72 0.25
73 0.34
74 0.4
75 0.47
76 0.54
77 0.62
78 0.71
79 0.75
80 0.76
81 0.71