Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194X5D5

Protein Details
Accession A0A194X5D5    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-42KLKGSTPSGITKKKKKKTPKPAPESEASHydrophilic
NLS Segment(s)
PositionSequence
22-35SGITKKKKKKTPKP
85-94EMRRKRLHER
Subcellular Location(s) nucl 21, cyto_nucl 12.833, mito_nucl 12.333, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
KEGG psco:LY89DRAFT_686160  -  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPSDDYTPVVRGALKLKGSTPSGITKKKKKKTPKPAPESEASTSKQSAFQKALEEEDASTKEDDLRELEERGHDGKTASERAREEMRRKRLHERLQKEGVKTHKERVEELNKYLSNLSEHHDMPRIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.24
4 0.27
5 0.29
6 0.28
7 0.27
8 0.31
9 0.36
10 0.44
11 0.51
12 0.57
13 0.66
14 0.74
15 0.8
16 0.83
17 0.86
18 0.88
19 0.91
20 0.91
21 0.9
22 0.89
23 0.85
24 0.78
25 0.72
26 0.64
27 0.57
28 0.48
29 0.41
30 0.33
31 0.29
32 0.3
33 0.26
34 0.27
35 0.24
36 0.23
37 0.24
38 0.24
39 0.25
40 0.19
41 0.18
42 0.14
43 0.14
44 0.14
45 0.12
46 0.11
47 0.1
48 0.1
49 0.1
50 0.1
51 0.09
52 0.1
53 0.1
54 0.11
55 0.11
56 0.1
57 0.12
58 0.13
59 0.12
60 0.1
61 0.09
62 0.1
63 0.13
64 0.18
65 0.17
66 0.2
67 0.2
68 0.23
69 0.31
70 0.35
71 0.41
72 0.45
73 0.54
74 0.58
75 0.61
76 0.68
77 0.7
78 0.74
79 0.76
80 0.73
81 0.71
82 0.74
83 0.73
84 0.66
85 0.62
86 0.59
87 0.58
88 0.55
89 0.55
90 0.49
91 0.47
92 0.48
93 0.51
94 0.54
95 0.49
96 0.49
97 0.49
98 0.45
99 0.45
100 0.43
101 0.35
102 0.27
103 0.25
104 0.26
105 0.23
106 0.24
107 0.25
108 0.3
109 0.28