Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194X0G8

Protein Details
Accession A0A194X0G8    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
39-70LRQPTMPVRSNKKERRNKKKKNSQLHRERAALHydrophilic
NLS Segment(s)
PositionSequence
48-71SNKKERRNKKKKNSQLHRERAALK
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR045518  2EXR  
KEGG psco:LY89DRAFT_158369  -  
Pfam View protein in Pfam  
PF20150  2EXR  
Amino Acid Sequences MLRSQGALYNRAGQHIGLDEVTNLKPMEVPKEVIELLMLRQPTMPVRSNKKERRNKKKKNSQLHRERAALKRVTRLGNSDGDNKFKFDPDRPYETGKTLTEFTLFNELAPEVRFMIWKEAFPAPQAVKIRSDAVNYEQRPTLLTVVHRMRYRAKGSYVPSPLLSSSTCSRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.21
4 0.13
5 0.13
6 0.12
7 0.14
8 0.15
9 0.15
10 0.13
11 0.12
12 0.14
13 0.15
14 0.2
15 0.19
16 0.21
17 0.19
18 0.23
19 0.22
20 0.2
21 0.19
22 0.14
23 0.13
24 0.14
25 0.13
26 0.1
27 0.1
28 0.11
29 0.14
30 0.18
31 0.23
32 0.27
33 0.36
34 0.45
35 0.56
36 0.64
37 0.72
38 0.78
39 0.83
40 0.87
41 0.9
42 0.92
43 0.92
44 0.94
45 0.93
46 0.94
47 0.94
48 0.93
49 0.93
50 0.91
51 0.85
52 0.78
53 0.74
54 0.68
55 0.64
56 0.58
57 0.49
58 0.45
59 0.44
60 0.42
61 0.37
62 0.34
63 0.3
64 0.29
65 0.29
66 0.3
67 0.27
68 0.29
69 0.28
70 0.27
71 0.24
72 0.22
73 0.22
74 0.19
75 0.26
76 0.27
77 0.34
78 0.34
79 0.39
80 0.38
81 0.38
82 0.37
83 0.29
84 0.26
85 0.21
86 0.19
87 0.15
88 0.14
89 0.13
90 0.16
91 0.16
92 0.14
93 0.13
94 0.13
95 0.13
96 0.13
97 0.12
98 0.07
99 0.08
100 0.09
101 0.09
102 0.16
103 0.16
104 0.15
105 0.18
106 0.2
107 0.2
108 0.2
109 0.24
110 0.18
111 0.23
112 0.26
113 0.24
114 0.24
115 0.26
116 0.28
117 0.24
118 0.25
119 0.21
120 0.24
121 0.31
122 0.3
123 0.31
124 0.29
125 0.28
126 0.28
127 0.28
128 0.24
129 0.17
130 0.18
131 0.24
132 0.29
133 0.35
134 0.35
135 0.36
136 0.41
137 0.46
138 0.5
139 0.46
140 0.45
141 0.46
142 0.49
143 0.55
144 0.53
145 0.48
146 0.44
147 0.4
148 0.36
149 0.32
150 0.28
151 0.24