Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A132B8B2

Protein Details
Accession A0A132B8B2    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-27NTPSKSRRIASRAKVQRRNAHydrophilic
54-74LSGKKARKVEKAKNHARKRAIBasic
NLS Segment(s)
PositionSequence
12-41KSRRIASRAKVQRRNAVNKVTKNPRGTRKS
53-73LLSGKKARKVEKAKNHARKRA
Subcellular Location(s) nucl 13.5, mito_nucl 13, mito 11.5
Family & Domain DBs
KEGG psco:LY89DRAFT_629081  -  
Amino Acid Sequences MASRGNPNTPSKSRRIASRAKVQRRNAVNKVTKNPRGTRKSTVLAPTSGPAALLSGKKARKVEKAKNHARKRAIEKAMEQEGEVEMTDAPKTTKSKAAAKDGDGMELDAVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.61
3 0.62
4 0.63
5 0.68
6 0.72
7 0.74
8 0.8
9 0.77
10 0.78
11 0.78
12 0.78
13 0.74
14 0.73
15 0.71
16 0.68
17 0.72
18 0.73
19 0.71
20 0.69
21 0.7
22 0.7
23 0.69
24 0.67
25 0.65
26 0.61
27 0.57
28 0.54
29 0.52
30 0.44
31 0.38
32 0.33
33 0.27
34 0.22
35 0.18
36 0.14
37 0.08
38 0.07
39 0.08
40 0.07
41 0.08
42 0.13
43 0.14
44 0.18
45 0.21
46 0.24
47 0.31
48 0.4
49 0.48
50 0.53
51 0.62
52 0.7
53 0.78
54 0.82
55 0.81
56 0.78
57 0.75
58 0.73
59 0.73
60 0.67
61 0.6
62 0.55
63 0.53
64 0.52
65 0.44
66 0.36
67 0.27
68 0.22
69 0.2
70 0.16
71 0.11
72 0.06
73 0.07
74 0.07
75 0.07
76 0.07
77 0.12
78 0.14
79 0.16
80 0.23
81 0.27
82 0.35
83 0.41
84 0.5
85 0.5
86 0.5
87 0.55
88 0.49
89 0.46
90 0.38
91 0.32