Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A132BBU1

Protein Details
Accession A0A132BBU1   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
81-108KILKARGKGAPKKKRTAEESKKFKGKKRBasic
NLS Segment(s)
PositionSequence
82-108ILKARGKGAPKKKRTAEESKKFKGKKR
Subcellular Location(s) mito 15.5, cyto_mito 9.5, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG psco:LY89DRAFT_676482  -  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MAVPRSRILDLMKVQCRIFSTTFNPEGLRLGNKILRQRLKGPALASYYPRKVATIQDLQKLYPEFDEFIDEAEEDRLEGIKILKARGKGAPKKKRTAEESKKFKGKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.42
3 0.42
4 0.39
5 0.34
6 0.29
7 0.29
8 0.33
9 0.35
10 0.34
11 0.32
12 0.28
13 0.28
14 0.25
15 0.22
16 0.15
17 0.17
18 0.19
19 0.22
20 0.27
21 0.34
22 0.37
23 0.38
24 0.42
25 0.46
26 0.46
27 0.45
28 0.4
29 0.36
30 0.35
31 0.33
32 0.31
33 0.28
34 0.27
35 0.26
36 0.25
37 0.22
38 0.19
39 0.2
40 0.22
41 0.25
42 0.26
43 0.29
44 0.3
45 0.29
46 0.3
47 0.29
48 0.23
49 0.16
50 0.15
51 0.11
52 0.1
53 0.13
54 0.1
55 0.1
56 0.1
57 0.09
58 0.09
59 0.09
60 0.08
61 0.06
62 0.06
63 0.06
64 0.05
65 0.06
66 0.07
67 0.09
68 0.11
69 0.14
70 0.17
71 0.18
72 0.21
73 0.27
74 0.36
75 0.43
76 0.53
77 0.61
78 0.66
79 0.74
80 0.79
81 0.81
82 0.79
83 0.81
84 0.81
85 0.81
86 0.83
87 0.83
88 0.85