Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194XN92

Protein Details
Accession A0A194XN92    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPANTGAKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
8-23AKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 9, nucl 8, cyto_mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG psco:LY89DRAFT_607992  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPANTGAKKQKKKWSKGKVKDKAQHAVILDKAISDKLYKDVQSYRLITVATLVDRLKINGSLARRCLADLEEKGQIKKVVGHSKLSIYTRAVGGDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.89
4 0.9
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.48
15 0.38
16 0.31
17 0.24
18 0.17
19 0.15
20 0.12
21 0.11
22 0.08
23 0.08
24 0.1
25 0.13
26 0.13
27 0.15
28 0.18
29 0.21
30 0.25
31 0.25
32 0.23
33 0.21
34 0.2
35 0.18
36 0.16
37 0.13
38 0.08
39 0.09
40 0.08
41 0.09
42 0.09
43 0.1
44 0.09
45 0.09
46 0.1
47 0.12
48 0.15
49 0.17
50 0.18
51 0.2
52 0.19
53 0.19
54 0.19
55 0.17
56 0.2
57 0.18
58 0.2
59 0.25
60 0.26
61 0.26
62 0.29
63 0.28
64 0.23
65 0.27
66 0.32
67 0.36
68 0.37
69 0.41
70 0.4
71 0.42
72 0.47
73 0.44
74 0.39
75 0.32
76 0.31
77 0.28