Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A132B6Z3

Protein Details
Accession A0A132B6Z3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
24-45VITCCTCQRRRSRKIGGLKPGEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 15, cyto 5, mito 3, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG psco:LY89DRAFT_677068  -  
Amino Acid Sequences MAVSVGLTIGIAIATFILGLTIGVITCCTCQRRRSRKIGGLKPGESIQRYAGRKVAFRFVEYVIQKQEEWYQDGEGTKKWFLEQIPKIDKNQKALTPKARLRLPTLGAGQDVEAGSGVVEHVHVDVWNDKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.02
5 0.03
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.04
12 0.05
13 0.06
14 0.1
15 0.14
16 0.19
17 0.27
18 0.38
19 0.49
20 0.57
21 0.66
22 0.72
23 0.76
24 0.82
25 0.83
26 0.81
27 0.77
28 0.69
29 0.61
30 0.54
31 0.49
32 0.39
33 0.32
34 0.26
35 0.27
36 0.28
37 0.27
38 0.28
39 0.26
40 0.28
41 0.29
42 0.32
43 0.25
44 0.24
45 0.25
46 0.22
47 0.27
48 0.25
49 0.25
50 0.19
51 0.2
52 0.19
53 0.17
54 0.2
55 0.15
56 0.16
57 0.14
58 0.13
59 0.14
60 0.15
61 0.15
62 0.13
63 0.14
64 0.13
65 0.13
66 0.12
67 0.14
68 0.14
69 0.22
70 0.25
71 0.31
72 0.39
73 0.41
74 0.45
75 0.5
76 0.51
77 0.48
78 0.48
79 0.45
80 0.43
81 0.48
82 0.52
83 0.54
84 0.55
85 0.56
86 0.55
87 0.52
88 0.52
89 0.51
90 0.45
91 0.41
92 0.39
93 0.33
94 0.3
95 0.28
96 0.22
97 0.19
98 0.16
99 0.11
100 0.08
101 0.07
102 0.06
103 0.06
104 0.06
105 0.04
106 0.04
107 0.04
108 0.04
109 0.05
110 0.06
111 0.08