Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194XGJ1

Protein Details
Accession A0A194XGJ1    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
51-70LFRLDNVLRTKRRRKVKAPPHydrophilic
NLS Segment(s)
PositionSequence
60-70TKRRRKVKAPP
Subcellular Location(s) mito 22, nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG psco:LY89DRAFT_507242  -  
Amino Acid Sequences MHQLPSWTRKAIYRSRSRRHICTSLMTTAFNSLNKVPLTFTPFAFLTSMSLFRLDNVLRTKRRRKVKAPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.69
3 0.78
4 0.79
5 0.79
6 0.78
7 0.73
8 0.65
9 0.61
10 0.56
11 0.5
12 0.45
13 0.38
14 0.3
15 0.27
16 0.25
17 0.19
18 0.17
19 0.12
20 0.15
21 0.14
22 0.14
23 0.12
24 0.13
25 0.18
26 0.18
27 0.17
28 0.17
29 0.17
30 0.17
31 0.17
32 0.15
33 0.11
34 0.11
35 0.12
36 0.1
37 0.11
38 0.1
39 0.1
40 0.14
41 0.13
42 0.17
43 0.23
44 0.32
45 0.39
46 0.49
47 0.58
48 0.63
49 0.74
50 0.78