Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A132BDG1

Protein Details
Accession A0A132BDG1   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
59-102NGYVGPKHTKKQRKQGKKAEKSLAKKAAKKEKKSAEKNKEESEABasic
NLS Segment(s)
PositionSequence
52-96QKREEEKNGYVGPKHTKKQRKQGKKAEKSLAKKAAKKEKKSAEKN
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
KEGG psco:LY89DRAFT_740177  -  
Amino Acid Sequences MSYNDPVPLFDTTASEPSAFSRRPTPKYKLKSAKQLDAADERREAAAELRAQKREEEKNGYVGPKHTKKQRKQGKKAEKSLAKKAAKKEKKSAEKNKEESEADDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.16
3 0.15
4 0.17
5 0.23
6 0.21
7 0.2
8 0.28
9 0.34
10 0.41
11 0.48
12 0.53
13 0.57
14 0.63
15 0.72
16 0.73
17 0.72
18 0.76
19 0.74
20 0.73
21 0.7
22 0.64
23 0.57
24 0.55
25 0.51
26 0.42
27 0.37
28 0.3
29 0.23
30 0.21
31 0.18
32 0.11
33 0.12
34 0.13
35 0.19
36 0.21
37 0.23
38 0.24
39 0.25
40 0.29
41 0.31
42 0.32
43 0.32
44 0.3
45 0.33
46 0.34
47 0.34
48 0.3
49 0.29
50 0.33
51 0.32
52 0.37
53 0.42
54 0.5
55 0.57
56 0.66
57 0.74
58 0.76
59 0.81
60 0.87
61 0.89
62 0.89
63 0.9
64 0.89
65 0.87
66 0.82
67 0.81
68 0.8
69 0.76
70 0.72
71 0.72
72 0.74
73 0.74
74 0.75
75 0.76
76 0.76
77 0.8
78 0.85
79 0.87
80 0.87
81 0.87
82 0.87
83 0.83
84 0.79
85 0.69
86 0.62