Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194XI38

Protein Details
Accession A0A194XI38   
Localization Confidence Low
Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-36FNYHRFGCKKEGKKYKKTSRHFATAVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, mito_nucl 14, nucl 7
Family & Domain DBs
KEGG psco:LY89DRAFT_461539  -  
Amino Acid Sequences MVLHPIRTRSFNYHRFGCKKEGKKYKKTSRHFATAVNRTRTSTLEGWNPNHWTTEAYHWMTKKCLFEVIEYKSRSLKSGYFVFCLLAEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.65
3 0.64
4 0.64
5 0.65
6 0.66
7 0.7
8 0.73
9 0.73
10 0.78
11 0.85
12 0.87
13 0.88
14 0.86
15 0.86
16 0.82
17 0.8
18 0.71
19 0.68
20 0.66
21 0.64
22 0.64
23 0.59
24 0.53
25 0.46
26 0.46
27 0.39
28 0.35
29 0.28
30 0.22
31 0.23
32 0.26
33 0.27
34 0.29
35 0.3
36 0.26
37 0.25
38 0.22
39 0.17
40 0.16
41 0.18
42 0.22
43 0.22
44 0.25
45 0.26
46 0.27
47 0.29
48 0.31
49 0.28
50 0.23
51 0.26
52 0.23
53 0.26
54 0.32
55 0.35
56 0.39
57 0.38
58 0.39
59 0.38
60 0.38
61 0.35
62 0.32
63 0.28
64 0.25
65 0.32
66 0.34
67 0.32
68 0.32
69 0.31