Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194XG45

Protein Details
Accession A0A194XG45   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
53-80GSRNEERERRRREEQQRKQNQQQPQQEQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 4, cyto 3
Family & Domain DBs
KEGG psco:LY89DRAFT_683041  -  
Amino Acid Sequences MSSILSFGSGTWDCCNCSCSCCDGDNGSIATGGGGNSGADVGWIDLGGDSGDGSRNEERERRRREEQQRKQNQQQPQQEQMSYVASNDHRDDLKREI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.18
4 0.2
5 0.2
6 0.2
7 0.22
8 0.21
9 0.23
10 0.22
11 0.22
12 0.23
13 0.21
14 0.17
15 0.15
16 0.13
17 0.11
18 0.08
19 0.07
20 0.05
21 0.04
22 0.04
23 0.03
24 0.04
25 0.03
26 0.03
27 0.03
28 0.03
29 0.02
30 0.02
31 0.03
32 0.02
33 0.03
34 0.03
35 0.03
36 0.02
37 0.03
38 0.05
39 0.05
40 0.08
41 0.09
42 0.1
43 0.13
44 0.18
45 0.26
46 0.34
47 0.42
48 0.46
49 0.52
50 0.61
51 0.71
52 0.77
53 0.8
54 0.82
55 0.85
56 0.87
57 0.89
58 0.86
59 0.84
60 0.82
61 0.82
62 0.78
63 0.75
64 0.7
65 0.61
66 0.55
67 0.48
68 0.41
69 0.31
70 0.24
71 0.2
72 0.18
73 0.22
74 0.22
75 0.24
76 0.23
77 0.26