Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5A1E7

Protein Details
Accession E5A1E7    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-38IGTIDSKAEEKKKKKKSKICIQPKAIPAHydrophilic
NLS Segment(s)
PositionSequence
19-42EEKKKKKKSKICIQPKAIPAKKKK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MRKLQHNTTTIGTIDSKAEEKKKKKKSKICIQPKAIPAKKKKCTAFPATVYRYAGSIPIPNPRALLKHTKKPQHAFDTNPAQPSPALLPTITIPIPTPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.18
4 0.21
5 0.29
6 0.36
7 0.45
8 0.54
9 0.64
10 0.73
11 0.81
12 0.85
13 0.88
14 0.89
15 0.91
16 0.92
17 0.91
18 0.87
19 0.84
20 0.8
21 0.8
22 0.74
23 0.71
24 0.69
25 0.7
26 0.7
27 0.7
28 0.67
29 0.64
30 0.66
31 0.65
32 0.61
33 0.56
34 0.57
35 0.52
36 0.51
37 0.44
38 0.37
39 0.3
40 0.24
41 0.19
42 0.12
43 0.11
44 0.1
45 0.16
46 0.18
47 0.18
48 0.19
49 0.19
50 0.2
51 0.21
52 0.31
53 0.3
54 0.39
55 0.47
56 0.54
57 0.62
58 0.66
59 0.71
60 0.7
61 0.68
62 0.63
63 0.63
64 0.64
65 0.59
66 0.55
67 0.47
68 0.38
69 0.34
70 0.31
71 0.26
72 0.18
73 0.17
74 0.14
75 0.15
76 0.15
77 0.19
78 0.17
79 0.15