Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A132B266

Protein Details
Accession A0A132B266    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
63-82RTCMDMPRPKNQKKNTINYHHydrophilic
NLS Segment(s)
PositionSequence
95-97KRK
Subcellular Location(s) nucl 15, mito 9, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG psco:LY89DRAFT_712578  -  
Amino Acid Sequences MPPKGAATKLQPMRLPPLPKLRVRRPNQADANPCLALMSSVLTCWASAGYNVAGCQALETQLRTCMDMPRPKNQKKNTINYHLSRMYPNIVGPRKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.49
3 0.46
4 0.51
5 0.51
6 0.56
7 0.63
8 0.66
9 0.69
10 0.71
11 0.75
12 0.72
13 0.75
14 0.76
15 0.74
16 0.68
17 0.62
18 0.6
19 0.49
20 0.42
21 0.32
22 0.24
23 0.17
24 0.12
25 0.09
26 0.05
27 0.04
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.04
34 0.04
35 0.05
36 0.05
37 0.05
38 0.05
39 0.06
40 0.06
41 0.05
42 0.06
43 0.05
44 0.06
45 0.07
46 0.08
47 0.08
48 0.12
49 0.13
50 0.13
51 0.14
52 0.18
53 0.24
54 0.32
55 0.35
56 0.41
57 0.51
58 0.58
59 0.66
60 0.69
61 0.73
62 0.74
63 0.81
64 0.8
65 0.79
66 0.8
67 0.74
68 0.74
69 0.66
70 0.59
71 0.51
72 0.45
73 0.39
74 0.32
75 0.31
76 0.34
77 0.38