Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194XG98

Protein Details
Accession A0A194XG98    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
61-82VLKPAPKKAKPKLRAKTDNEEVHydrophilic
NLS Segment(s)
PositionSequence
64-75PAPKKAKPKLRA
Subcellular Location(s) mito_nucl 11.833, mito 11.5, nucl 11, cyto_nucl 8.333
Family & Domain DBs
KEGG psco:LY89DRAFT_683089  -  
Amino Acid Sequences MVLTRSQRKAALESGSSVTATTDHNDASKPPKSSNVAREEPLAQSDKTTAEDATTPSLNVVLKPAPKKAKPKLRAKTDNEEVPMLVYKVTMDDLMPPPSESVVEIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.26
4 0.22
5 0.17
6 0.13
7 0.13
8 0.11
9 0.1
10 0.1
11 0.11
12 0.11
13 0.13
14 0.19
15 0.23
16 0.24
17 0.24
18 0.29
19 0.34
20 0.39
21 0.45
22 0.47
23 0.44
24 0.43
25 0.44
26 0.39
27 0.34
28 0.31
29 0.25
30 0.17
31 0.15
32 0.15
33 0.13
34 0.13
35 0.13
36 0.11
37 0.09
38 0.1
39 0.1
40 0.11
41 0.1
42 0.09
43 0.08
44 0.09
45 0.09
46 0.08
47 0.09
48 0.09
49 0.13
50 0.15
51 0.22
52 0.28
53 0.33
54 0.42
55 0.5
56 0.58
57 0.64
58 0.73
59 0.76
60 0.8
61 0.84
62 0.82
63 0.82
64 0.78
65 0.74
66 0.65
67 0.57
68 0.46
69 0.37
70 0.32
71 0.23
72 0.16
73 0.11
74 0.08
75 0.08
76 0.09
77 0.08
78 0.07
79 0.12
80 0.15
81 0.18
82 0.19
83 0.19
84 0.19
85 0.19
86 0.19