Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194XPQ4

Protein Details
Accession A0A194XPQ4    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-49MVSAKKHVPIVKKRVKRFHRHQSDTYKCLDASWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
12-16KKRVK
Subcellular Location(s) mito 16.5, mito_nucl 12.333, nucl 7, cyto_nucl 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG psco:LY89DRAFT_681458  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKRVKRFHRHQSDTYKCLDASWRKPKGIDNRVRRRFKGQMVMPSIGFGSNRKTRHMMPSGHKAFLVNNVRDVDLLLMHNKTFAAEISHAVSSRKRIEIITRAKELGVKVTNPKARITTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.87
4 0.88
5 0.88
6 0.89
7 0.87
8 0.86
9 0.87
10 0.85
11 0.77
12 0.7
13 0.61
14 0.5
15 0.43
16 0.43
17 0.4
18 0.41
19 0.49
20 0.5
21 0.49
22 0.5
23 0.57
24 0.59
25 0.62
26 0.61
27 0.62
28 0.68
29 0.77
30 0.82
31 0.77
32 0.73
33 0.69
34 0.65
35 0.63
36 0.56
37 0.54
38 0.53
39 0.52
40 0.44
41 0.38
42 0.32
43 0.23
44 0.19
45 0.12
46 0.13
47 0.17
48 0.18
49 0.2
50 0.23
51 0.24
52 0.31
53 0.36
54 0.36
55 0.35
56 0.44
57 0.45
58 0.42
59 0.41
60 0.34
61 0.29
62 0.32
63 0.34
64 0.24
65 0.24
66 0.25
67 0.25
68 0.24
69 0.24
70 0.16
71 0.1
72 0.1
73 0.09
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.08
80 0.07
81 0.09
82 0.09
83 0.11
84 0.13
85 0.14
86 0.14
87 0.15
88 0.17
89 0.19
90 0.22
91 0.23
92 0.22
93 0.23
94 0.29
95 0.37
96 0.45
97 0.46
98 0.45
99 0.44
100 0.43
101 0.44
102 0.38
103 0.37
104 0.31
105 0.28
106 0.31
107 0.4
108 0.45
109 0.43
110 0.46
111 0.42