Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A132B7G9

Protein Details
Accession A0A132B7G9   
Localization Confidence High
Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
113-158DTYRPRSLSRSRSPRRHRTRSRSLSSRSRSRSPPRRRGGGRRDSPGBasic
NLS Segment(s)
PositionSequence
90-103FRPPPPTRRRTPPP
116-167RPRSLSRSRSPRRHRTRSRSLSSRSRSRSPPRRRGGGRRDSPGRNGGRRRRS
180-193SRSRSRGRGGRGRR
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
KEGG psco:LY89DRAFT_599958  -  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences LREIFSTYGQIRDLDMPMNRAFNTNRGTAYILYASETDAEAAIAHMHESQIDGAVINVSIVLPRRKFSPSPPMARRGANIDPRVPLAAPFRPPPPTRRRTPPPAYGRTERNFDTYRPRSLSRSRSPRRHRTRSRSLSSRSRSRSPPRRRGGGRRDSPGRNGGRRRRSPSYSSYSSYDDRSRSRSRGRGGRGRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.23
4 0.24
5 0.26
6 0.24
7 0.25
8 0.26
9 0.27
10 0.29
11 0.27
12 0.26
13 0.25
14 0.27
15 0.24
16 0.25
17 0.2
18 0.16
19 0.15
20 0.15
21 0.13
22 0.11
23 0.11
24 0.09
25 0.07
26 0.07
27 0.06
28 0.06
29 0.06
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.06
36 0.06
37 0.06
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.04
44 0.04
45 0.03
46 0.04
47 0.08
48 0.12
49 0.13
50 0.14
51 0.17
52 0.21
53 0.22
54 0.27
55 0.35
56 0.37
57 0.46
58 0.49
59 0.52
60 0.51
61 0.51
62 0.46
63 0.41
64 0.4
65 0.38
66 0.36
67 0.32
68 0.3
69 0.29
70 0.29
71 0.23
72 0.19
73 0.15
74 0.15
75 0.16
76 0.17
77 0.18
78 0.23
79 0.25
80 0.3
81 0.37
82 0.4
83 0.43
84 0.5
85 0.56
86 0.6
87 0.65
88 0.67
89 0.66
90 0.67
91 0.67
92 0.63
93 0.62
94 0.55
95 0.52
96 0.43
97 0.4
98 0.35
99 0.31
100 0.37
101 0.34
102 0.36
103 0.37
104 0.38
105 0.37
106 0.43
107 0.51
108 0.5
109 0.58
110 0.62
111 0.69
112 0.76
113 0.82
114 0.86
115 0.88
116 0.89
117 0.87
118 0.89
119 0.89
120 0.88
121 0.85
122 0.82
123 0.81
124 0.78
125 0.78
126 0.73
127 0.69
128 0.69
129 0.72
130 0.75
131 0.76
132 0.79
133 0.77
134 0.81
135 0.83
136 0.84
137 0.84
138 0.84
139 0.8
140 0.79
141 0.79
142 0.73
143 0.69
144 0.68
145 0.65
146 0.63
147 0.66
148 0.67
149 0.7
150 0.75
151 0.79
152 0.78
153 0.77
154 0.74
155 0.72
156 0.71
157 0.66
158 0.61
159 0.56
160 0.53
161 0.49
162 0.48
163 0.45
164 0.42
165 0.41
166 0.44
167 0.48
168 0.5
169 0.57
170 0.6
171 0.64
172 0.68
173 0.73