Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194XCK6

Protein Details
Accession A0A194XCK6    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
177-196ATADKVKRGRKRKSTVLEAEHydrophilic
NLS Segment(s)
PositionSequence
145-173RAKRVVKDAAKAAKGKGKRGRKCKSATPE
177-189ATADKVKRGRKRK
Subcellular Location(s) cyto_mito 10.333, mito 10, cyto 9.5, mito_nucl 9.333, nucl 7.5
Family & Domain DBs
KEGG psco:LY89DRAFT_584597  -  
Amino Acid Sequences KNIKAGFAASGLFPFNPDRVLRSMPAPAEPAIPSTDEVKVWTCRQDVEPQTPVTPVSVESFMSLGNLIIQQDAHALDETSKQNLVRHLQKCTKAFKKSSALGVLQEDRIQLLTTINNEAKVRRSTKSLVLGKAKVMSYEDLEEARAKRVVKDAAKAAKGKGKRGRKCKSATPEAEEATADKVKRGRKRKSTVLEAEAEEPEPEPNPKIARMRKALASSRALVMETPIAEDEIVPELRRAPVAPVAKMW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.16
4 0.16
5 0.19
6 0.21
7 0.25
8 0.25
9 0.26
10 0.3
11 0.28
12 0.29
13 0.28
14 0.25
15 0.24
16 0.22
17 0.21
18 0.17
19 0.17
20 0.16
21 0.16
22 0.17
23 0.14
24 0.16
25 0.18
26 0.21
27 0.22
28 0.26
29 0.24
30 0.25
31 0.28
32 0.35
33 0.37
34 0.39
35 0.41
36 0.38
37 0.38
38 0.36
39 0.34
40 0.25
41 0.2
42 0.14
43 0.13
44 0.12
45 0.11
46 0.11
47 0.11
48 0.1
49 0.1
50 0.09
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.07
64 0.13
65 0.14
66 0.14
67 0.15
68 0.15
69 0.17
70 0.21
71 0.26
72 0.3
73 0.32
74 0.38
75 0.43
76 0.49
77 0.51
78 0.56
79 0.58
80 0.56
81 0.56
82 0.55
83 0.55
84 0.51
85 0.5
86 0.45
87 0.38
88 0.32
89 0.32
90 0.27
91 0.21
92 0.19
93 0.15
94 0.11
95 0.11
96 0.09
97 0.07
98 0.06
99 0.07
100 0.07
101 0.11
102 0.11
103 0.12
104 0.13
105 0.13
106 0.16
107 0.2
108 0.21
109 0.19
110 0.23
111 0.23
112 0.27
113 0.36
114 0.36
115 0.36
116 0.38
117 0.37
118 0.34
119 0.35
120 0.31
121 0.22
122 0.19
123 0.15
124 0.12
125 0.12
126 0.12
127 0.09
128 0.1
129 0.12
130 0.12
131 0.13
132 0.14
133 0.13
134 0.14
135 0.18
136 0.23
137 0.23
138 0.26
139 0.3
140 0.33
141 0.36
142 0.36
143 0.34
144 0.34
145 0.34
146 0.4
147 0.43
148 0.47
149 0.52
150 0.62
151 0.68
152 0.71
153 0.74
154 0.74
155 0.74
156 0.74
157 0.7
158 0.65
159 0.61
160 0.53
161 0.48
162 0.39
163 0.31
164 0.25
165 0.24
166 0.18
167 0.16
168 0.2
169 0.26
170 0.36
171 0.45
172 0.52
173 0.59
174 0.67
175 0.75
176 0.79
177 0.81
178 0.79
179 0.74
180 0.67
181 0.58
182 0.53
183 0.43
184 0.35
185 0.26
186 0.19
187 0.16
188 0.13
189 0.13
190 0.12
191 0.15
192 0.17
193 0.22
194 0.3
195 0.37
196 0.44
197 0.48
198 0.51
199 0.53
200 0.58
201 0.6
202 0.57
203 0.54
204 0.47
205 0.43
206 0.4
207 0.35
208 0.27
209 0.22
210 0.19
211 0.14
212 0.14
213 0.12
214 0.12
215 0.11
216 0.11
217 0.11
218 0.12
219 0.13
220 0.12
221 0.13
222 0.14
223 0.16
224 0.17
225 0.16
226 0.16
227 0.23
228 0.27