Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194WZV9

Protein Details
Accession A0A194WZV9    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
535-556SPEINKKKAKPMKSPPQPPPEIHydrophilic
679-703PSANTSPNTTNKRRRPSVKDESEVQHydrophilic
NLS Segment(s)
PositionSequence
538-547INKKKAKPMK
717-725PRIGGKRQK
Subcellular Location(s) nucl 21.5, cyto_nucl 15.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029005  LIM-bd/SEUSS  
KEGG psco:LY89DRAFT_699108  -  
Pfam View protein in Pfam  
PF01803  LIM_bind  
Amino Acid Sequences MMTSLAQSYSPHPGGMQPHPGMAQGHPGMAVPHNPGQPGQPGPGMPQQLHMGVSGPGPQVSQAGVMMGGMPPGAGGPSQHALQHLNPNQAAQQQQLFQQQQIAFANANPSMQQIQQQQMIQHQRQQQAARQAMLAQQYSGMPMQMANGMNQMTQAQFQAMRGGPVARPVNLPQHLQQQQQQVAEHNLQQQQQAQAQAQAQHQVWFSESRIFSRHQQQLIMAQQLAMQQQASQQAQAGNNPQGQGNQMNPQQPQNMQAQTAMMQQAHQQQQQAAHAAAASQQSQGQPQPQPQSQQAQPNAQAQAQQPQPAQQQQQGIQQQQAVAAAMLQQQQRQGEKFKGQCLMKLMQFGDHLSNFGATSKSLASYTATGAQRLAAQSSKQRDDLNYWLTFVDRFFSPKGVFRHSLWILDETSNKQYEITYPALPRYFYTHFESGVKNMQMIMEKGTEKELPNNGHYIESQKSSFVYWFDNGSQLVASGTLKAHFDADQKIELLEFVTSSHEEYIPRAQVLDAARPLHEWSKEWRKVNAPPDGKQSPEINKKKAKPMKSPPQPPPEIDLPESLVSKMGITPLVFRFLEIAEVMGQMNPLFGYSHQNSSLDPYAALNQYVATVAVNGADNSGGQQPNPTGPRTPGMGNFGMGVSPAQAHLQLPDGSPHVSGSPAPGMAPQHSQHGTSSSGPSANTSPNTTNKRRRPSVKDESEVQVNGNPSKTAVKPSPRIGGKRQKGNPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.4
4 0.33
5 0.34
6 0.34
7 0.36
8 0.33
9 0.28
10 0.3
11 0.22
12 0.22
13 0.2
14 0.2
15 0.2
16 0.2
17 0.22
18 0.19
19 0.24
20 0.25
21 0.26
22 0.27
23 0.27
24 0.31
25 0.31
26 0.28
27 0.25
28 0.24
29 0.28
30 0.33
31 0.34
32 0.29
33 0.29
34 0.29
35 0.27
36 0.27
37 0.23
38 0.18
39 0.15
40 0.16
41 0.17
42 0.15
43 0.14
44 0.14
45 0.14
46 0.13
47 0.13
48 0.13
49 0.08
50 0.08
51 0.07
52 0.07
53 0.07
54 0.06
55 0.06
56 0.05
57 0.04
58 0.04
59 0.04
60 0.05
61 0.04
62 0.05
63 0.09
64 0.11
65 0.12
66 0.14
67 0.16
68 0.18
69 0.22
70 0.32
71 0.33
72 0.37
73 0.36
74 0.37
75 0.37
76 0.38
77 0.36
78 0.29
79 0.28
80 0.23
81 0.27
82 0.35
83 0.34
84 0.3
85 0.36
86 0.33
87 0.34
88 0.33
89 0.31
90 0.23
91 0.22
92 0.25
93 0.19
94 0.19
95 0.14
96 0.15
97 0.15
98 0.15
99 0.21
100 0.22
101 0.25
102 0.29
103 0.31
104 0.31
105 0.37
106 0.45
107 0.42
108 0.44
109 0.48
110 0.48
111 0.52
112 0.54
113 0.52
114 0.52
115 0.53
116 0.47
117 0.4
118 0.37
119 0.34
120 0.35
121 0.29
122 0.19
123 0.16
124 0.15
125 0.17
126 0.15
127 0.12
128 0.08
129 0.08
130 0.08
131 0.12
132 0.12
133 0.11
134 0.13
135 0.13
136 0.13
137 0.13
138 0.13
139 0.1
140 0.1
141 0.1
142 0.1
143 0.1
144 0.1
145 0.15
146 0.15
147 0.15
148 0.15
149 0.16
150 0.15
151 0.22
152 0.23
153 0.19
154 0.21
155 0.23
156 0.3
157 0.31
158 0.34
159 0.29
160 0.37
161 0.4
162 0.41
163 0.44
164 0.44
165 0.45
166 0.45
167 0.43
168 0.36
169 0.36
170 0.35
171 0.33
172 0.31
173 0.3
174 0.29
175 0.3
176 0.3
177 0.29
178 0.29
179 0.29
180 0.24
181 0.23
182 0.24
183 0.27
184 0.25
185 0.26
186 0.24
187 0.24
188 0.24
189 0.21
190 0.2
191 0.17
192 0.17
193 0.2
194 0.2
195 0.19
196 0.21
197 0.24
198 0.28
199 0.35
200 0.41
201 0.35
202 0.36
203 0.35
204 0.39
205 0.39
206 0.36
207 0.27
208 0.2
209 0.2
210 0.21
211 0.2
212 0.14
213 0.11
214 0.08
215 0.11
216 0.16
217 0.15
218 0.13
219 0.15
220 0.17
221 0.18
222 0.2
223 0.22
224 0.2
225 0.21
226 0.21
227 0.2
228 0.18
229 0.19
230 0.19
231 0.17
232 0.19
233 0.21
234 0.25
235 0.26
236 0.28
237 0.28
238 0.27
239 0.28
240 0.28
241 0.25
242 0.22
243 0.21
244 0.19
245 0.17
246 0.18
247 0.17
248 0.11
249 0.1
250 0.13
251 0.2
252 0.24
253 0.24
254 0.23
255 0.23
256 0.25
257 0.27
258 0.25
259 0.18
260 0.14
261 0.12
262 0.11
263 0.12
264 0.11
265 0.1
266 0.08
267 0.1
268 0.1
269 0.12
270 0.14
271 0.16
272 0.17
273 0.22
274 0.27
275 0.28
276 0.31
277 0.32
278 0.36
279 0.35
280 0.41
281 0.39
282 0.37
283 0.38
284 0.39
285 0.37
286 0.32
287 0.32
288 0.24
289 0.28
290 0.25
291 0.26
292 0.22
293 0.24
294 0.27
295 0.28
296 0.29
297 0.26
298 0.28
299 0.27
300 0.34
301 0.35
302 0.32
303 0.29
304 0.28
305 0.24
306 0.21
307 0.19
308 0.12
309 0.07
310 0.06
311 0.06
312 0.07
313 0.1
314 0.11
315 0.11
316 0.13
317 0.15
318 0.17
319 0.18
320 0.2
321 0.2
322 0.26
323 0.27
324 0.28
325 0.33
326 0.31
327 0.31
328 0.32
329 0.31
330 0.26
331 0.26
332 0.24
333 0.19
334 0.19
335 0.18
336 0.16
337 0.13
338 0.12
339 0.09
340 0.1
341 0.08
342 0.08
343 0.08
344 0.05
345 0.06
346 0.06
347 0.07
348 0.06
349 0.07
350 0.07
351 0.07
352 0.08
353 0.14
354 0.14
355 0.13
356 0.13
357 0.13
358 0.14
359 0.13
360 0.13
361 0.08
362 0.09
363 0.14
364 0.19
365 0.2
366 0.21
367 0.22
368 0.22
369 0.24
370 0.28
371 0.27
372 0.23
373 0.21
374 0.2
375 0.19
376 0.18
377 0.14
378 0.12
379 0.07
380 0.09
381 0.09
382 0.12
383 0.12
384 0.18
385 0.21
386 0.24
387 0.26
388 0.25
389 0.32
390 0.3
391 0.31
392 0.26
393 0.25
394 0.21
395 0.2
396 0.21
397 0.16
398 0.19
399 0.18
400 0.17
401 0.15
402 0.14
403 0.14
404 0.17
405 0.17
406 0.17
407 0.17
408 0.2
409 0.2
410 0.21
411 0.19
412 0.21
413 0.2
414 0.21
415 0.25
416 0.24
417 0.24
418 0.26
419 0.26
420 0.23
421 0.26
422 0.22
423 0.17
424 0.16
425 0.16
426 0.15
427 0.15
428 0.14
429 0.12
430 0.12
431 0.12
432 0.14
433 0.16
434 0.15
435 0.19
436 0.22
437 0.22
438 0.23
439 0.25
440 0.23
441 0.21
442 0.21
443 0.2
444 0.17
445 0.17
446 0.16
447 0.15
448 0.15
449 0.14
450 0.15
451 0.13
452 0.14
453 0.12
454 0.14
455 0.14
456 0.15
457 0.14
458 0.14
459 0.12
460 0.09
461 0.09
462 0.07
463 0.07
464 0.06
465 0.06
466 0.07
467 0.08
468 0.08
469 0.09
470 0.1
471 0.12
472 0.14
473 0.16
474 0.16
475 0.16
476 0.15
477 0.14
478 0.12
479 0.11
480 0.07
481 0.06
482 0.05
483 0.07
484 0.07
485 0.08
486 0.09
487 0.1
488 0.1
489 0.12
490 0.17
491 0.16
492 0.16
493 0.15
494 0.14
495 0.17
496 0.19
497 0.21
498 0.19
499 0.18
500 0.18
501 0.19
502 0.21
503 0.21
504 0.2
505 0.18
506 0.24
507 0.34
508 0.41
509 0.43
510 0.46
511 0.47
512 0.53
513 0.59
514 0.6
515 0.54
516 0.5
517 0.55
518 0.53
519 0.49
520 0.45
521 0.43
522 0.43
523 0.49
524 0.53
525 0.53
526 0.59
527 0.63
528 0.7
529 0.73
530 0.71
531 0.71
532 0.75
533 0.78
534 0.8
535 0.84
536 0.82
537 0.84
538 0.79
539 0.71
540 0.66
541 0.6
542 0.54
543 0.46
544 0.38
545 0.31
546 0.29
547 0.28
548 0.22
549 0.17
550 0.13
551 0.12
552 0.11
553 0.1
554 0.1
555 0.09
556 0.13
557 0.13
558 0.18
559 0.18
560 0.17
561 0.17
562 0.16
563 0.17
564 0.13
565 0.12
566 0.08
567 0.09
568 0.09
569 0.08
570 0.08
571 0.06
572 0.07
573 0.06
574 0.06
575 0.06
576 0.06
577 0.14
578 0.16
579 0.2
580 0.22
581 0.22
582 0.22
583 0.27
584 0.29
585 0.22
586 0.2
587 0.18
588 0.21
589 0.21
590 0.21
591 0.15
592 0.12
593 0.12
594 0.12
595 0.11
596 0.06
597 0.06
598 0.05
599 0.07
600 0.07
601 0.07
602 0.07
603 0.07
604 0.07
605 0.08
606 0.14
607 0.13
608 0.12
609 0.15
610 0.16
611 0.23
612 0.26
613 0.27
614 0.24
615 0.26
616 0.29
617 0.29
618 0.31
619 0.27
620 0.3
621 0.29
622 0.26
623 0.24
624 0.22
625 0.18
626 0.16
627 0.12
628 0.07
629 0.07
630 0.07
631 0.07
632 0.08
633 0.08
634 0.09
635 0.13
636 0.14
637 0.14
638 0.16
639 0.17
640 0.17
641 0.17
642 0.17
643 0.14
644 0.13
645 0.13
646 0.14
647 0.14
648 0.14
649 0.13
650 0.15
651 0.17
652 0.19
653 0.24
654 0.21
655 0.26
656 0.27
657 0.28
658 0.27
659 0.27
660 0.28
661 0.26
662 0.28
663 0.23
664 0.24
665 0.23
666 0.25
667 0.25
668 0.27
669 0.27
670 0.29
671 0.31
672 0.38
673 0.47
674 0.54
675 0.62
676 0.66
677 0.74
678 0.79
679 0.84
680 0.84
681 0.86
682 0.87
683 0.86
684 0.82
685 0.77
686 0.72
687 0.68
688 0.59
689 0.5
690 0.43
691 0.37
692 0.34
693 0.31
694 0.26
695 0.22
696 0.26
697 0.27
698 0.31
699 0.36
700 0.42
701 0.48
702 0.54
703 0.62
704 0.64
705 0.68
706 0.71
707 0.74
708 0.73
709 0.77