Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A194XD78

Protein Details
Accession A0A194XD78    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
103-122MEKKEKMREGKEKKDREKAEBasic
NLS Segment(s)
PositionSequence
104-135EKKEKMREGKEKKDREKAEEKKRLWEEKAKKK
Subcellular Location(s) nucl 21.5, cyto_nucl 14.5, cyto 4.5
Family & Domain DBs
KEGG psco:LY89DRAFT_717732  -  
Amino Acid Sequences MSEPTSPVAENSYKKPLPLSPSNNGRPGTSGTELGLRANREKASSAYERAQRAEAAYRAKRRATYARKDYQAAKEHFKNAGKSFKEGSKCAWLAVKAGPAILMEKKEKMREGKEKKDREKAEEKKRLWEEKAKKKSVDEGTDGEEAIPTVQPVSADV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.38
4 0.39
5 0.46
6 0.48
7 0.47
8 0.56
9 0.61
10 0.64
11 0.6
12 0.53
13 0.45
14 0.42
15 0.38
16 0.31
17 0.26
18 0.21
19 0.23
20 0.23
21 0.23
22 0.22
23 0.19
24 0.19
25 0.22
26 0.22
27 0.2
28 0.21
29 0.21
30 0.24
31 0.25
32 0.26
33 0.29
34 0.33
35 0.34
36 0.34
37 0.33
38 0.27
39 0.26
40 0.26
41 0.23
42 0.26
43 0.3
44 0.34
45 0.36
46 0.38
47 0.38
48 0.38
49 0.45
50 0.46
51 0.5
52 0.53
53 0.57
54 0.57
55 0.58
56 0.58
57 0.55
58 0.55
59 0.48
60 0.45
61 0.4
62 0.4
63 0.42
64 0.41
65 0.37
66 0.32
67 0.37
68 0.32
69 0.31
70 0.31
71 0.32
72 0.32
73 0.3
74 0.29
75 0.28
76 0.27
77 0.25
78 0.25
79 0.21
80 0.19
81 0.2
82 0.19
83 0.12
84 0.12
85 0.11
86 0.09
87 0.11
88 0.11
89 0.12
90 0.12
91 0.16
92 0.19
93 0.21
94 0.26
95 0.3
96 0.36
97 0.44
98 0.52
99 0.59
100 0.66
101 0.74
102 0.77
103 0.81
104 0.77
105 0.74
106 0.76
107 0.75
108 0.76
109 0.77
110 0.7
111 0.7
112 0.74
113 0.73
114 0.68
115 0.69
116 0.68
117 0.69
118 0.78
119 0.74
120 0.69
121 0.65
122 0.69
123 0.67
124 0.62
125 0.55
126 0.48
127 0.46
128 0.44
129 0.41
130 0.32
131 0.23
132 0.18
133 0.14
134 0.12
135 0.07
136 0.07
137 0.07