Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A132B8W3

Protein Details
Accession A0A132B8W3    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
86-114YTELSRTFQRKKARRQRKQEKMVDQGKIQHydrophilic
NLS Segment(s)
PositionSequence
95-103RKKARRQRK
Subcellular Location(s) nucl 13, mito 7, cyto 5
Family & Domain DBs
KEGG psco:LY89DRAFT_676743  -  
Amino Acid Sequences MTVPSWSWHRCNCSRDCQQDSEKARGLHGHGPAWQNSARAIENASQRFLQDHLDMGRARNLISDWLKEGYMPSEGSLNVGEWGFTYTELSRTFQRKKARRQRKQEKMVDQGKIQSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.68
3 0.67
4 0.66
5 0.64
6 0.66
7 0.65
8 0.62
9 0.57
10 0.49
11 0.45
12 0.4
13 0.39
14 0.35
15 0.33
16 0.27
17 0.27
18 0.29
19 0.28
20 0.29
21 0.26
22 0.21
23 0.2
24 0.21
25 0.17
26 0.14
27 0.15
28 0.16
29 0.22
30 0.22
31 0.23
32 0.2
33 0.2
34 0.2
35 0.19
36 0.17
37 0.11
38 0.12
39 0.11
40 0.14
41 0.14
42 0.14
43 0.16
44 0.14
45 0.13
46 0.12
47 0.11
48 0.13
49 0.14
50 0.14
51 0.13
52 0.13
53 0.13
54 0.13
55 0.13
56 0.1
57 0.1
58 0.09
59 0.08
60 0.08
61 0.08
62 0.09
63 0.09
64 0.08
65 0.08
66 0.07
67 0.07
68 0.06
69 0.08
70 0.07
71 0.07
72 0.08
73 0.08
74 0.12
75 0.13
76 0.15
77 0.2
78 0.28
79 0.33
80 0.38
81 0.49
82 0.54
83 0.64
84 0.74
85 0.79
86 0.82
87 0.88
88 0.92
89 0.93
90 0.95
91 0.93
92 0.91
93 0.9
94 0.87
95 0.81
96 0.72