Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A132B8N8

Protein Details
Accession A0A132B8N8    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
86-111PSSPEACTSRPRKRQKTAQRPEPIPEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
KEGG psco:LY89DRAFT_742331  -  
Amino Acid Sequences MNNGSVNTPMPRSGTRTPSHTKIRRSSPKSITPTRGSVPANRSKIGNMLSTSKNDSPRGRISSKGTPAAQVSVPQTSSEAISELVPSSPEACTSRPRKRQKTAQRPEPIPEDISSSQSSAHSPWRRLRPIVVIDGRDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.44
4 0.49
5 0.53
6 0.62
7 0.63
8 0.65
9 0.65
10 0.73
11 0.76
12 0.76
13 0.78
14 0.75
15 0.77
16 0.77
17 0.76
18 0.72
19 0.66
20 0.63
21 0.56
22 0.54
23 0.46
24 0.44
25 0.43
26 0.45
27 0.44
28 0.41
29 0.39
30 0.33
31 0.36
32 0.32
33 0.27
34 0.2
35 0.21
36 0.22
37 0.23
38 0.28
39 0.27
40 0.29
41 0.31
42 0.31
43 0.31
44 0.35
45 0.39
46 0.36
47 0.36
48 0.37
49 0.39
50 0.41
51 0.4
52 0.35
53 0.31
54 0.29
55 0.28
56 0.22
57 0.17
58 0.15
59 0.12
60 0.12
61 0.1
62 0.1
63 0.09
64 0.09
65 0.08
66 0.07
67 0.06
68 0.06
69 0.07
70 0.06
71 0.06
72 0.06
73 0.06
74 0.07
75 0.06
76 0.08
77 0.1
78 0.11
79 0.19
80 0.28
81 0.38
82 0.47
83 0.58
84 0.65
85 0.73
86 0.82
87 0.85
88 0.88
89 0.89
90 0.89
91 0.88
92 0.81
93 0.77
94 0.71
95 0.62
96 0.53
97 0.42
98 0.39
99 0.3
100 0.31
101 0.27
102 0.22
103 0.21
104 0.19
105 0.2
106 0.16
107 0.25
108 0.29
109 0.34
110 0.42
111 0.51
112 0.56
113 0.57
114 0.59
115 0.58
116 0.56
117 0.6
118 0.57