Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194WSA3

Protein Details
Accession A0A194WSA3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
89-108EVDPKARRPPRRRDGFTGTPBasic
NLS Segment(s)
PositionSequence
95-100RRPPRR
Subcellular Location(s) pero 7, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
KEGG psco:LY89DRAFT_558278  -  
Pfam View protein in Pfam  
PF13637  Ank_4  
PROSITE View protein in PROSITE  
PS50297  ANK_REP_REGION  
PS50088  ANK_REPEAT  
Amino Acid Sequences YMLEHGWNPSSYGHNDAHPLTIAAQSFPPSTLKFLLDHGVSPRGTQAMHAAVTWAAIDGEITGGVVTDPTRYEVLDLLLQYGADVNEMEVDPKARRPPRRRDGFTGTPLHRAIGQESLEMVKYLLENGASP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.25
4 0.25
5 0.21
6 0.19
7 0.16
8 0.17
9 0.15
10 0.13
11 0.13
12 0.14
13 0.14
14 0.14
15 0.15
16 0.13
17 0.16
18 0.17
19 0.17
20 0.16
21 0.17
22 0.19
23 0.17
24 0.18
25 0.17
26 0.2
27 0.18
28 0.17
29 0.17
30 0.14
31 0.13
32 0.12
33 0.12
34 0.1
35 0.11
36 0.1
37 0.1
38 0.09
39 0.09
40 0.08
41 0.06
42 0.04
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.02
50 0.02
51 0.02
52 0.03
53 0.03
54 0.03
55 0.04
56 0.05
57 0.06
58 0.06
59 0.06
60 0.07
61 0.08
62 0.09
63 0.09
64 0.08
65 0.08
66 0.08
67 0.07
68 0.07
69 0.06
70 0.05
71 0.05
72 0.04
73 0.05
74 0.05
75 0.06
76 0.06
77 0.08
78 0.08
79 0.12
80 0.21
81 0.27
82 0.38
83 0.46
84 0.57
85 0.66
86 0.76
87 0.79
88 0.78
89 0.8
90 0.78
91 0.76
92 0.74
93 0.65
94 0.59
95 0.53
96 0.45
97 0.38
98 0.32
99 0.27
100 0.24
101 0.22
102 0.18
103 0.18
104 0.19
105 0.18
106 0.16
107 0.14
108 0.1
109 0.09
110 0.09
111 0.1