Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A194X5T9

Protein Details
Accession A0A194X5T9   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
109-134LSRIRTRKGRMTLARRRAKKRSTLSHHydrophilic
NLS Segment(s)
PositionSequence
102-130RKRRHGFLSRIRTRKGRMTLARRRAKKRS
Subcellular Location(s) nucl 12.5, mito 10.5, cyto_nucl 8.333, cyto_mito 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG psco:LY89DRAFT_783674  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLCLRCSHGFNAALKPSTFSQPAVRSFFKAFSRRTFTSFRGPSRPTVFPSSFTFPASLSASPLPISAETLDLLPKISTHPALGATQIRCGPRNTFSPSHFVRKRRHGFLSRIRTRKGRMTLARRRAKKRSTLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.32
4 0.33
5 0.31
6 0.26
7 0.29
8 0.31
9 0.37
10 0.4
11 0.39
12 0.37
13 0.38
14 0.41
15 0.41
16 0.42
17 0.4
18 0.41
19 0.48
20 0.46
21 0.49
22 0.49
23 0.45
24 0.49
25 0.51
26 0.48
27 0.48
28 0.48
29 0.49
30 0.5
31 0.49
32 0.42
33 0.43
34 0.39
35 0.35
36 0.37
37 0.37
38 0.32
39 0.31
40 0.27
41 0.2
42 0.22
43 0.21
44 0.16
45 0.13
46 0.12
47 0.11
48 0.11
49 0.11
50 0.09
51 0.07
52 0.07
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.05
61 0.05
62 0.06
63 0.07
64 0.07
65 0.07
66 0.08
67 0.09
68 0.09
69 0.11
70 0.15
71 0.14
72 0.16
73 0.19
74 0.2
75 0.2
76 0.22
77 0.23
78 0.22
79 0.27
80 0.31
81 0.32
82 0.32
83 0.38
84 0.4
85 0.47
86 0.5
87 0.52
88 0.54
89 0.6
90 0.67
91 0.66
92 0.71
93 0.68
94 0.72
95 0.75
96 0.78
97 0.77
98 0.75
99 0.73
100 0.71
101 0.68
102 0.68
103 0.65
104 0.64
105 0.64
106 0.68
107 0.74
108 0.79
109 0.84
110 0.84
111 0.86
112 0.86
113 0.84
114 0.83