FuNGI

A0A194XQ77

Protein Details

Accession

A0A194XQ77

Localization Confidence

Medium

Confidence Score

11.8

NoLS Segment(s)

Position	Sequence	Protein Nature
70-96	TADSSRLRAPKRRARRTSPAKQDRVNF	Hydrophilic

NLS Segment(s)

Position	Sequence
77-86	RAPKRRARRT

Subcellular Location(s)

nucl 13.5, cyto_nucl 10, mito 7, cyto 5.5

Family & Domain DBs

InterPro	View protein in InterPro IPR021162 Dot1 IPR025789 DOT1_dom IPR030445 H3-K79_meTrfase IPR029063 SAM-dependent_MTases_sf
Gene Ontology	GO:0000781 C:chromosome, telomeric region GO:0000786 C:nucleosome GO:0005634 C:nucleus GO:0042393 F:histone binding GO:0140956 F:histone H3K79 trimethyltransferase activity GO:0000077 P:DNA damage checkpoint signaling GO:0006281 P:DNA repair GO:0034729 P:histone H3-K79 methylation GO:0031509 P:subtelomeric heterochromatin formation
KEGG	psco:LY89DRAFT_638470 -
Pfam	View protein in Pfam PF08123 DOT1
PROSITE	View protein in PROSITE PS51569 DOT1
CDD	cd02440 AdoMet_MTases

Amino Acid Sequences

MNLFGGKSNIKRVQAVVRTVRVADPKGPEPRPSAVRQHSQTTQTHRATASPAGESPSTPRSSPGTPSVDTADSSRLRAPKRRARRTSPAKQDRVNFGSDGDEDEEDTDDNHARKKQKLAGSIDSKRQLRQKQAFSEEDGGVFDMIHAANISFVGKRNKNSEPVTEHVTVKLQYPSSSQQESYNLVFGRDLIDPCKEILAIAKIVTEVYLTPDQAIAFDEPNSGILRQLVKARNILKKEPTNPDLLENFKSAVDTYNKSITNLIKEGAITKNLDNRHHLPLNMIRCMLRQVYDRAVSPRVDLLKQYENGTDNVYGELLPNFISEALSKTGLKSDQVFVDLGSGVGNVVLQAALEFGCESWGCEMMKNATDLADAQASEFNARCRLWGIQPGEVHLERGDFLESQAIHEAMKKADVILVNNQAFTPDLNQKLVQLFLDLKDGCKIVSLKSFVPDGYKITSRNLGNPVNLLSVQKGEYYSESVSWTDAGGTYFIATKDEKRLKKWADQH

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.5
2	0.55
3	0.53
4	0.51
5	0.5
6	0.5
7	0.5
8	0.46
9	0.43
10	0.4
11	0.38
12	0.41
13	0.49
14	0.5
15	0.5
16	0.49
17	0.53
18	0.53
19	0.53
20	0.56
21	0.54
22	0.61
23	0.6
24	0.63
25	0.62
26	0.62
27	0.63
28	0.62
29	0.63
30	0.57
31	0.56
32	0.5
33	0.45
34	0.43
35	0.41
36	0.35
37	0.27
38	0.26
39	0.25
40	0.25
41	0.24
42	0.25
43	0.26
44	0.26
45	0.24
46	0.26
47	0.27
48	0.29
49	0.33
50	0.37
51	0.36
52	0.34
53	0.36
54	0.37
55	0.33
56	0.31
57	0.29
58	0.28
59	0.24
60	0.25
61	0.28
62	0.3
63	0.35
64	0.43
65	0.51
66	0.55
67	0.65
68	0.74
69	0.78
70	0.81
71	0.87
72	0.89
73	0.89
74	0.9
75	0.89
76	0.86
77	0.83
78	0.8
79	0.77
80	0.69
81	0.61
82	0.5
83	0.4
84	0.35
85	0.29
86	0.25
87	0.19
88	0.16
89	0.13
90	0.14
91	0.14
92	0.11
93	0.11
94	0.1
95	0.12
96	0.13
97	0.17
98	0.22
99	0.26
100	0.31
101	0.38
102	0.44
103	0.46
104	0.53
105	0.55
106	0.59
107	0.63
108	0.64
109	0.64
110	0.64
111	0.6
112	0.56
113	0.58
114	0.55
115	0.57
116	0.6
117	0.61
118	0.61
119	0.66
120	0.64
121	0.59
122	0.58
123	0.47
124	0.39
125	0.31
126	0.23
127	0.17
128	0.14
129	0.1
130	0.07
131	0.06
132	0.06
133	0.05
134	0.05
135	0.05
136	0.05
137	0.06
138	0.06
139	0.1
140	0.19
141	0.22
142	0.26
143	0.32
144	0.35
145	0.41
146	0.43
147	0.45
148	0.41
149	0.41
150	0.44
151	0.41
152	0.38
153	0.32
154	0.31
155	0.26
156	0.23
157	0.23
158	0.18
159	0.16
160	0.19
161	0.22
162	0.25
163	0.26
164	0.25
165	0.24
166	0.26
167	0.28
168	0.26
169	0.25
170	0.2
171	0.18
172	0.17
173	0.15
174	0.15
175	0.14
176	0.13
177	0.11
178	0.12
179	0.12
180	0.13
181	0.13
182	0.1
183	0.08
184	0.1
185	0.1
186	0.1
187	0.09
188	0.09
189	0.09
190	0.09
191	0.09
192	0.07
193	0.05
194	0.08
195	0.09
196	0.09
197	0.09
198	0.1
199	0.1
200	0.1
201	0.11
202	0.08
203	0.07
204	0.08
205	0.08
206	0.07
207	0.08
208	0.09
209	0.07
210	0.07
211	0.08
212	0.09
213	0.1
214	0.16
215	0.19
216	0.2
217	0.24
218	0.3
219	0.34
220	0.36
221	0.38
222	0.39
223	0.41
224	0.45
225	0.47
226	0.43
227	0.41
228	0.38
229	0.38
230	0.33
231	0.3
232	0.26
233	0.2
234	0.19
235	0.15
236	0.15
237	0.12
238	0.13
239	0.13
240	0.13
241	0.15
242	0.19
243	0.19
244	0.2
245	0.22
246	0.2
247	0.2
248	0.19
249	0.18
250	0.13
251	0.13
252	0.15
253	0.13
254	0.13
255	0.12
256	0.12
257	0.16
258	0.19
259	0.21
260	0.24
261	0.26
262	0.3
263	0.31
264	0.3
265	0.28
266	0.31
267	0.33
268	0.29
269	0.26
270	0.2
271	0.19
272	0.21
273	0.18
274	0.15
275	0.14
276	0.15
277	0.18
278	0.2
279	0.21
280	0.21
281	0.23
282	0.22
283	0.2
284	0.21
285	0.19
286	0.18
287	0.18
288	0.19
289	0.22
290	0.23
291	0.23
292	0.22
293	0.22
294	0.22
295	0.23
296	0.19
297	0.14
298	0.13
299	0.12
300	0.09
301	0.08
302	0.08
303	0.06
304	0.06
305	0.05
306	0.05
307	0.05
308	0.05
309	0.05
310	0.07
311	0.09
312	0.1
313	0.1
314	0.11
315	0.13
316	0.14
317	0.15
318	0.15
319	0.15
320	0.14
321	0.16
322	0.15
323	0.12
324	0.13
325	0.11
326	0.09
327	0.07
328	0.06
329	0.04
330	0.04
331	0.04
332	0.03
333	0.03
334	0.03
335	0.02
336	0.02
337	0.03
338	0.03
339	0.03
340	0.03
341	0.03
342	0.05
343	0.05
344	0.06
345	0.06
346	0.09
347	0.09
348	0.1
349	0.12
350	0.13
351	0.14
352	0.15
353	0.14
354	0.11
355	0.11
356	0.11
357	0.12
358	0.1
359	0.09
360	0.09
361	0.1
362	0.1
363	0.12
364	0.12
365	0.12
366	0.15
367	0.16
368	0.15
369	0.16
370	0.19
371	0.2
372	0.27
373	0.29
374	0.29
375	0.3
376	0.31
377	0.34
378	0.32
379	0.29
380	0.22
381	0.19
382	0.15
383	0.15
384	0.15
385	0.09
386	0.1
387	0.13
388	0.13
389	0.14
390	0.15
391	0.15
392	0.13
393	0.16
394	0.18
395	0.14
396	0.16
397	0.14
398	0.12
399	0.15
400	0.17
401	0.16
402	0.2
403	0.27
404	0.27
405	0.27
406	0.26
407	0.24
408	0.22
409	0.2
410	0.2
411	0.18
412	0.21
413	0.23
414	0.23
415	0.25
416	0.26
417	0.27
418	0.22
419	0.18
420	0.17
421	0.15
422	0.22
423	0.2
424	0.19
425	0.21
426	0.21
427	0.18
428	0.21
429	0.21
430	0.18
431	0.25
432	0.27
433	0.26
434	0.28
435	0.3
436	0.26
437	0.29
438	0.27
439	0.23
440	0.25
441	0.27
442	0.26
443	0.29
444	0.36
445	0.33
446	0.38
447	0.42
448	0.4
449	0.38
450	0.38
451	0.36
452	0.32
453	0.32
454	0.27
455	0.21
456	0.19
457	0.19
458	0.18
459	0.17
460	0.16
461	0.17
462	0.2
463	0.2
464	0.19
465	0.2
466	0.19
467	0.19
468	0.17
469	0.15
470	0.12
471	0.12
472	0.11
473	0.1
474	0.09
475	0.09
476	0.12
477	0.12
478	0.14
479	0.15
480	0.18
481	0.28
482	0.37
483	0.42
484	0.45
485	0.55
486	0.59

A0A194XQ77

3D AlphaFold-predicted Structure Viewer