Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4ZJH4

Protein Details
Accession E4ZJH4   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
88-116APRARPRAPAARRPRRRARESRARQSRGWBasic
NLS Segment(s)
PositionSequence
83-121ARPADAPRARPRAPAARRPRRRARESRARQSRGWWRGWG
Subcellular Location(s) mito 18, nucl 5, cyto 2
Family & Domain DBs
Amino Acid Sequences MDMDRGVVVVIMAKRSMRVETVWRVWPPCWGFCNDSLSRHASLQQNHEGENAMAKIRYIGDEAKPTHQPLTPRPAPPSSPAQARPADAPRARPRAPAARRPRRRARESRARQSRGWWRGWGPGRPCGSRLGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.17
4 0.15
5 0.16
6 0.22
7 0.28
8 0.33
9 0.37
10 0.38
11 0.39
12 0.37
13 0.42
14 0.39
15 0.36
16 0.34
17 0.31
18 0.32
19 0.32
20 0.39
21 0.33
22 0.32
23 0.31
24 0.31
25 0.29
26 0.27
27 0.29
28 0.27
29 0.29
30 0.32
31 0.36
32 0.33
33 0.32
34 0.32
35 0.27
36 0.22
37 0.2
38 0.15
39 0.09
40 0.08
41 0.08
42 0.08
43 0.07
44 0.08
45 0.08
46 0.09
47 0.1
48 0.15
49 0.17
50 0.19
51 0.2
52 0.2
53 0.2
54 0.2
55 0.21
56 0.2
57 0.28
58 0.3
59 0.3
60 0.33
61 0.33
62 0.33
63 0.34
64 0.36
65 0.3
66 0.3
67 0.3
68 0.32
69 0.31
70 0.31
71 0.31
72 0.29
73 0.34
74 0.3
75 0.36
76 0.4
77 0.46
78 0.46
79 0.45
80 0.46
81 0.49
82 0.54
83 0.56
84 0.59
85 0.63
86 0.73
87 0.79
88 0.85
89 0.84
90 0.88
91 0.88
92 0.88
93 0.88
94 0.88
95 0.9
96 0.9
97 0.85
98 0.77
99 0.75
100 0.76
101 0.71
102 0.65
103 0.59
104 0.51
105 0.55
106 0.6
107 0.59
108 0.53
109 0.54
110 0.56
111 0.53
112 0.52