FuNGI

A0A132B8N0

Protein Details

Accession

A0A132B8N0

Localization Confidence

High

Confidence Score

17.7

NoLS Segment(s)

Position	Sequence	Protein Nature
67-95	IAELKERLKTKTKPKSKSKQDNQQDEGTF	Hydrophilic
149-168	KLPGDSKKRKARARALKAYA	Hydrophilic
345-366	NTAPLKPKSQHRKPPDQAPPSP	Hydrophilic

NLS Segment(s)

Position	Sequence
75-82	KTKTKPKS
155-163	KKRKARARA

Subcellular Location(s)

mito_nucl 12.333, nucl 12, mito 11.5, cyto_nucl 8.333

Family & Domain DBs

InterPro	View protein in InterPro IPR016193 Cytidine_deaminase-like
Gene Ontology	GO:0003824 F:catalytic activity GO:0006139 P:nucleobase-containing compound metabolic process
KEGG	psco:LY89DRAFT_725363 -

Amino Acid Sequences

MSPRNDTYLSLALAQANLSPLHYRHGAIIVRGGKVIGQGFNCYKPGFDGGALKTGSLPSSSIDGPAIAELKERLKTKTKPKSKSKQDNQQDEGTFTPFESMGCGHNANAPLSMHSEMMAIKSALSLSSGTLSSQTSARSAKCFEKPCFKLPGDSKKRKARARALKAYAAAVCLEASTGQAYGGKFSIQKQSFEPGTSQPGQQGEQQVQRQGGEQWVSRSEGGRGGESERKCRETPQEEKPAGYYPHGPQHKHYQHKRGSEPHAYRSSDNSGSLATCLSSPTDDFIKSKTPKNKNPTFPPSVTPKPQQILITKNKSLNAKHSVAARTKDLRLKGSDLYVARLGTHNTAPLKPKSQHRKPPDQAPPSPPTLSKGPSSLYDELSPLCRSVSPSTSLPDPPDPEKPEIRASRPCYRCVAAMHSVGIKRVFWTTQDGEWEGAKVRDLVEALEMGLEGDGEVGTGQESKGVFVTKHEVLMLKRVMGL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.19
2	0.15
3	0.13
4	0.12
5	0.12
6	0.14
7	0.14
8	0.18
9	0.2
10	0.2
11	0.2
12	0.26
13	0.27
14	0.25
15	0.32
16	0.3
17	0.29
18	0.29
19	0.27
20	0.21
21	0.22
22	0.24
23	0.2
24	0.18
25	0.23
26	0.26
27	0.29
28	0.31
29	0.27
30	0.25
31	0.23
32	0.26
33	0.21
34	0.2
35	0.24
36	0.23
37	0.29
38	0.29
39	0.27
40	0.24
41	0.23
42	0.22
43	0.16
44	0.15
45	0.09
46	0.13
47	0.13
48	0.13
49	0.13
50	0.12
51	0.12
52	0.13
53	0.13
54	0.09
55	0.11
56	0.12
57	0.15
58	0.21
59	0.22
60	0.26
61	0.34
62	0.42
63	0.51
64	0.6
65	0.67
66	0.71
67	0.8
68	0.86
69	0.89
70	0.92
71	0.92
72	0.92
73	0.92
74	0.92
75	0.85
76	0.82
77	0.72
78	0.63
79	0.54
80	0.45
81	0.34
82	0.24
83	0.21
84	0.13
85	0.12
86	0.11
87	0.11
88	0.1
89	0.12
90	0.13
91	0.12
92	0.15
93	0.17
94	0.16
95	0.18
96	0.16
97	0.15
98	0.17
99	0.18
100	0.14
101	0.13
102	0.13
103	0.11
104	0.12
105	0.12
106	0.09
107	0.08
108	0.08
109	0.08
110	0.07
111	0.08
112	0.07
113	0.06
114	0.07
115	0.08
116	0.08
117	0.09
118	0.09
119	0.09
120	0.1
121	0.11
122	0.12
123	0.15
124	0.16
125	0.18
126	0.21
127	0.26
128	0.32
129	0.39
130	0.4
131	0.47
132	0.5
133	0.53
134	0.57
135	0.51
136	0.52
137	0.53
138	0.6
139	0.6
140	0.65
141	0.69
142	0.71
143	0.8
144	0.78
145	0.79
146	0.79
147	0.79
148	0.8
149	0.81
150	0.75
151	0.7
152	0.65
153	0.57
154	0.47
155	0.36
156	0.26
157	0.16
158	0.12
159	0.08
160	0.07
161	0.05
162	0.05
163	0.05
164	0.04
165	0.04
166	0.07
167	0.07
168	0.08
169	0.08
170	0.09
171	0.1
172	0.12
173	0.22
174	0.21
175	0.22
176	0.23
177	0.28
178	0.28
179	0.28
180	0.27
181	0.2
182	0.24
183	0.24
184	0.23
185	0.2
186	0.2
187	0.2
188	0.21
189	0.22
190	0.2
191	0.24
192	0.25
193	0.25
194	0.24
195	0.23
196	0.22
197	0.2
198	0.18
199	0.15
200	0.15
201	0.14
202	0.15
203	0.16
204	0.15
205	0.15
206	0.13
207	0.14
208	0.14
209	0.13
210	0.12
211	0.14
212	0.2
213	0.2
214	0.26
215	0.25
216	0.29
217	0.28
218	0.31
219	0.36
220	0.37
221	0.42
222	0.44
223	0.51
224	0.48
225	0.48
226	0.46
227	0.42
228	0.35
229	0.3
230	0.25
231	0.18
232	0.25
233	0.29
234	0.28
235	0.27
236	0.37
237	0.43
238	0.49
239	0.54
240	0.56
241	0.58
242	0.64
243	0.67
244	0.64
245	0.62
246	0.62
247	0.59
248	0.56
249	0.56
250	0.51
251	0.46
252	0.42
253	0.4
254	0.32
255	0.29
256	0.23
257	0.17
258	0.15
259	0.14
260	0.11
261	0.07
262	0.06
263	0.06
264	0.06
265	0.06
266	0.06
267	0.07
268	0.09
269	0.1
270	0.1
271	0.11
272	0.2
273	0.23
274	0.3
275	0.38
276	0.46
277	0.53
278	0.62
279	0.69
280	0.69
281	0.75
282	0.76
283	0.72
284	0.65
285	0.61
286	0.59
287	0.56
288	0.53
289	0.48
290	0.45
291	0.39
292	0.41
293	0.4
294	0.37
295	0.39
296	0.43
297	0.46
298	0.45
299	0.46
300	0.46
301	0.47
302	0.45
303	0.44
304	0.42
305	0.37
306	0.36
307	0.38
308	0.4
309	0.4
310	0.4
311	0.38
312	0.36
313	0.38
314	0.4
315	0.38
316	0.36
317	0.34
318	0.35
319	0.31
320	0.29
321	0.29
322	0.25
323	0.25
324	0.23
325	0.21
326	0.18
327	0.18
328	0.18
329	0.15
330	0.15
331	0.17
332	0.17
333	0.21
334	0.25
335	0.28
336	0.33
337	0.36
338	0.45
339	0.52
340	0.6
341	0.67
342	0.71
343	0.78
344	0.77
345	0.83
346	0.84
347	0.81
348	0.77
349	0.74
350	0.69
351	0.62
352	0.58
353	0.48
354	0.42
355	0.38
356	0.34
357	0.29
358	0.27
359	0.24
360	0.25
361	0.31
362	0.29
363	0.27
364	0.26
365	0.25
366	0.24
367	0.25
368	0.22
369	0.16
370	0.15
371	0.13
372	0.16
373	0.2
374	0.22
375	0.23
376	0.24
377	0.27
378	0.29
379	0.3
380	0.31
381	0.31
382	0.32
383	0.32
384	0.38
385	0.4
386	0.42
387	0.44
388	0.43
389	0.47
390	0.49
391	0.51
392	0.52
393	0.54
394	0.6
395	0.59
396	0.59
397	0.55
398	0.51
399	0.49
400	0.43
401	0.43
402	0.38
403	0.36
404	0.35
405	0.35
406	0.34
407	0.33
408	0.31
409	0.24
410	0.2
411	0.22
412	0.21
413	0.17
414	0.24
415	0.24
416	0.26
417	0.3
418	0.3
419	0.29
420	0.28
421	0.28
422	0.23
423	0.2
424	0.19
425	0.15
426	0.14
427	0.15
428	0.15
429	0.14
430	0.13
431	0.12
432	0.11
433	0.1
434	0.09
435	0.07
436	0.07
437	0.06
438	0.04
439	0.04
440	0.04
441	0.04
442	0.04
443	0.04
444	0.04
445	0.05
446	0.05
447	0.08
448	0.09
449	0.1
450	0.12
451	0.15
452	0.14
453	0.17
454	0.24
455	0.22
456	0.23
457	0.24
458	0.26
459	0.25
460	0.33
461	0.32

A0A132B8N0

3D AlphaFold-predicted Structure Viewer