Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0W6N1

Protein Details
Accession G0W6N1    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
95-120VFFPFSLKKLKKKERKSNPRDYPGKAHydrophilic
141-166FEYIFSTKWNERRPRKKNVLNTDHSHHydrophilic
NLS Segment(s)
PositionSequence
102-122KKLKKKERKSNPRDYPGKANK
Subcellular Location(s) mito 8, plas 7, E.R. 5, pero 2, golg 2, nucl 1, cyto 1, cyto_nucl 1, vacu 1
Family & Domain DBs
KEGG ndi:NDAI_0B04080  -  
Amino Acid Sequences MKVIIVSLIRVNIPLLSSITASGKTFLTGVMPKREDVAFSLNPFRDFRGRRIPSIFPDNFTWMLRAYISLGNISGLPKFKRGKCFPAGFLRHFSVFFPFSLKKLKKKERKSNPRDYPGKANKERVMFKFVIRFRVRKYENFEYIFSTKWNERRPRKKNVLNTDHSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.11
5 0.12
6 0.13
7 0.14
8 0.14
9 0.14
10 0.13
11 0.12
12 0.12
13 0.1
14 0.12
15 0.16
16 0.2
17 0.26
18 0.27
19 0.27
20 0.29
21 0.29
22 0.26
23 0.24
24 0.26
25 0.2
26 0.22
27 0.28
28 0.26
29 0.29
30 0.28
31 0.28
32 0.3
33 0.31
34 0.34
35 0.39
36 0.41
37 0.43
38 0.47
39 0.47
40 0.44
41 0.5
42 0.45
43 0.37
44 0.36
45 0.35
46 0.32
47 0.29
48 0.25
49 0.16
50 0.16
51 0.13
52 0.11
53 0.1
54 0.1
55 0.1
56 0.09
57 0.08
58 0.08
59 0.09
60 0.09
61 0.08
62 0.09
63 0.1
64 0.15
65 0.21
66 0.24
67 0.32
68 0.35
69 0.4
70 0.44
71 0.46
72 0.44
73 0.48
74 0.49
75 0.42
76 0.42
77 0.38
78 0.32
79 0.3
80 0.27
81 0.2
82 0.17
83 0.15
84 0.16
85 0.15
86 0.16
87 0.25
88 0.29
89 0.34
90 0.43
91 0.54
92 0.59
93 0.69
94 0.79
95 0.81
96 0.89
97 0.9
98 0.91
99 0.9
100 0.9
101 0.85
102 0.78
103 0.78
104 0.76
105 0.76
106 0.7
107 0.68
108 0.62
109 0.63
110 0.65
111 0.57
112 0.55
113 0.46
114 0.43
115 0.44
116 0.42
117 0.45
118 0.43
119 0.44
120 0.42
121 0.52
122 0.53
123 0.51
124 0.58
125 0.57
126 0.6
127 0.59
128 0.56
129 0.51
130 0.49
131 0.43
132 0.35
133 0.31
134 0.3
135 0.35
136 0.43
137 0.48
138 0.57
139 0.68
140 0.74
141 0.8
142 0.85
143 0.87
144 0.88
145 0.89
146 0.88