Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139AB28

Protein Details
Accession A0A139AB28    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
69-88IIYGGSKPRRRRKESAGTLAHydrophilic
NLS Segment(s)
PositionSequence
75-81KPRRRRK
Subcellular Location(s) cyto 8, extr 8, mito 7, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011856  tRNA_endonuc-like_dom_sf  
IPR036167  tRNA_intron_Endo_cat-like_sf  
IPR006677  tRNA_intron_Endonuc_cat-like  
IPR006678  tRNA_intron_Endonuc_N  
IPR006676  tRNA_splic  
IPR016589  tRNA_splic_SEN2  
Gene Ontology GO:0000214  C:tRNA-intron endonuclease complex  
GO:0016829  F:lyase activity  
GO:0003676  F:nucleic acid binding  
GO:0000213  F:tRNA-intron endonuclease activity  
GO:0006388  P:tRNA splicing, via endonucleolytic cleavage and ligation  
Pfam View protein in Pfam  
PF01974  tRNA_int_endo  
PF02778  tRNA_int_endo_N  
CDD cd22363  tRNA-intron_lyase_C  
Amino Acid Sequences MQPAWDHFHTIRIHFSYLISLLSSASPPTPRGLLVGAAAWVTSREDATRVWTEGHFGKGTLHRSEPEYIIYGGSKPRRRRKESAGTLAVDVDPATVAAEILQLSGVETMFLAAQARLNVEDNGGNLLSSSELWAHFTAQDPRFPLLYAVYKHYRKQGWVVRSGAVYAADYVLYRTGPAYDHSEFVVTVLSLETGTISDVDEHHSAPHSLFNLSRMSFQVKKDVLVCFVGAPKGPQPWCDDGSEVREVVVRRWLPERAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.26
4 0.23
5 0.22
6 0.15
7 0.12
8 0.11
9 0.12
10 0.12
11 0.1
12 0.12
13 0.13
14 0.14
15 0.16
16 0.16
17 0.15
18 0.16
19 0.17
20 0.15
21 0.14
22 0.13
23 0.11
24 0.1
25 0.09
26 0.08
27 0.07
28 0.07
29 0.07
30 0.07
31 0.08
32 0.09
33 0.1
34 0.16
35 0.18
36 0.18
37 0.19
38 0.19
39 0.22
40 0.23
41 0.26
42 0.2
43 0.17
44 0.2
45 0.24
46 0.28
47 0.28
48 0.27
49 0.26
50 0.28
51 0.31
52 0.27
53 0.24
54 0.22
55 0.19
56 0.18
57 0.17
58 0.15
59 0.19
60 0.26
61 0.31
62 0.39
63 0.49
64 0.58
65 0.66
66 0.71
67 0.75
68 0.78
69 0.8
70 0.8
71 0.74
72 0.65
73 0.57
74 0.5
75 0.4
76 0.29
77 0.2
78 0.1
79 0.06
80 0.04
81 0.04
82 0.03
83 0.03
84 0.03
85 0.04
86 0.04
87 0.04
88 0.04
89 0.03
90 0.04
91 0.04
92 0.04
93 0.03
94 0.03
95 0.04
96 0.03
97 0.04
98 0.04
99 0.04
100 0.05
101 0.05
102 0.06
103 0.06
104 0.08
105 0.08
106 0.08
107 0.08
108 0.07
109 0.08
110 0.08
111 0.07
112 0.05
113 0.05
114 0.05
115 0.04
116 0.05
117 0.04
118 0.04
119 0.06
120 0.07
121 0.07
122 0.07
123 0.09
124 0.16
125 0.16
126 0.18
127 0.19
128 0.2
129 0.19
130 0.19
131 0.18
132 0.13
133 0.16
134 0.15
135 0.18
136 0.24
137 0.26
138 0.28
139 0.34
140 0.33
141 0.3
142 0.38
143 0.4
144 0.38
145 0.41
146 0.41
147 0.36
148 0.35
149 0.33
150 0.26
151 0.19
152 0.14
153 0.09
154 0.07
155 0.06
156 0.06
157 0.06
158 0.06
159 0.05
160 0.05
161 0.05
162 0.06
163 0.06
164 0.09
165 0.14
166 0.14
167 0.15
168 0.15
169 0.16
170 0.15
171 0.14
172 0.13
173 0.07
174 0.06
175 0.06
176 0.05
177 0.05
178 0.05
179 0.05
180 0.04
181 0.05
182 0.04
183 0.05
184 0.05
185 0.06
186 0.1
187 0.11
188 0.11
189 0.12
190 0.13
191 0.13
192 0.13
193 0.16
194 0.13
195 0.14
196 0.14
197 0.16
198 0.19
199 0.19
200 0.2
201 0.19
202 0.25
203 0.28
204 0.29
205 0.36
206 0.32
207 0.33
208 0.35
209 0.34
210 0.3
211 0.27
212 0.26
213 0.18
214 0.2
215 0.19
216 0.16
217 0.17
218 0.18
219 0.24
220 0.25
221 0.26
222 0.3
223 0.34
224 0.36
225 0.35
226 0.34
227 0.3
228 0.34
229 0.35
230 0.29
231 0.23
232 0.25
233 0.23
234 0.23
235 0.29
236 0.25
237 0.25
238 0.3