Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139APH9

Protein Details
Accession A0A139APH9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-24ISSNCSFRTRRLPRRQCLIPFFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, extr 12, cyto_mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009091  RCC1/BLIP-II  
IPR000408  Reg_chr_condens  
Pfam View protein in Pfam  
PF00415  RCC1  
PROSITE View protein in PROSITE  
PS50012  RCC1_3  
Amino Acid Sequences MSISSNCSFRTRRLPRRQCLIPFFSVPTASASCNDFAGGWYTLAITESGKLFGWGLNQFGVLGTGDDEETRKVPTHIPPEARQALAVGCGRNHSSWLVGERPVARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.75
3 0.82
4 0.85
5 0.82
6 0.78
7 0.73
8 0.65
9 0.57
10 0.51
11 0.43
12 0.36
13 0.28
14 0.24
15 0.2
16 0.16
17 0.16
18 0.15
19 0.14
20 0.13
21 0.13
22 0.1
23 0.09
24 0.11
25 0.1
26 0.09
27 0.08
28 0.08
29 0.08
30 0.08
31 0.08
32 0.05
33 0.05
34 0.05
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.08
41 0.08
42 0.08
43 0.08
44 0.08
45 0.07
46 0.07
47 0.07
48 0.05
49 0.04
50 0.04
51 0.04
52 0.05
53 0.05
54 0.06
55 0.06
56 0.07
57 0.08
58 0.09
59 0.1
60 0.13
61 0.2
62 0.26
63 0.31
64 0.35
65 0.37
66 0.44
67 0.46
68 0.42
69 0.36
70 0.3
71 0.24
72 0.24
73 0.23
74 0.17
75 0.14
76 0.17
77 0.19
78 0.19
79 0.2
80 0.17
81 0.16
82 0.18
83 0.22
84 0.21
85 0.21
86 0.25